SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812447|ref|YP_320066.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812447|ref|YP_320066.1|
Domain Number 1 Region: 15-413
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.08e-124
Family GABA-aminotransferase-like 0.00000000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812447|ref|YP_320066.1|
Sequence length 415
Comment aminotransferase [Anabaena variabilis ATCC 29413]
Sequence
MQAANISLEISSFDTMNTQDYIELEQQYGADNYHPLDVVITKGEGVWVWDIEGKKYLDFL
SAYSALNQGHCHPKILQAMIKQAQQVTLTSRAFRNDQLGKFYQKLCQISGLPKVLPMNSG
AEAVETAIKAIRKWAYKVKGIPENQAEIIVCSNNFSGRTISLISFSTEEQYQDGFGPLTT
GFKVIPFGDAQALEQAITPNTAAFLVEPIQGEGGIIVPPHGFLKQAEQICRHHHVLLVFD
EIQTGLGRTGKMFAHQYENVKPDGITVGKALSGGFYPISAFISTEEVMGIFQPGDHGSTF
GGNPLAAAIGIAALDVLIEEKLPEKALKLGEYFIEKLQSIESTYIKEVRGKGLLIGMELY
PEAGGARRFCKALAKEGLLAKETRDNVIRFAPPLVISEDEIDWALEKIERVLTTT
Download sequence
Identical sequences Q3M2A9
240292.Ava_B0165 gi|75812447|ref|YP_320066.1| gi|75812447|ref|YP_320066.1|NC_007410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]