SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812579|ref|YP_320198.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75812579|ref|YP_320198.1|
Domain Number - Region: 63-100
Classification Level Classification E-value
Superfamily Ribosomal protein S16 0.0471
Family Ribosomal protein S16 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812579|ref|YP_320198.1|
Sequence length 131
Comment hypothetical protein Ava_B0298 [Anabaena variabilis ATCC 29413]
Sequence
MGKKRITQLLEGLKENQLRDLHNSAAIYTVAQVAVNELQQQSSQIEKPALAALPPSLEII
DKARLLEQYGSYNACRKAAKERGIKFSRTPSWEQLGAALSYAEAFQQIINSYVQTHPYPK
LKGTTFELVFP
Download sequence
Identical sequences A0A1W5CKQ9 Q3M1X7
gi|75812579|ref|YP_320198.1|NC_007410 240292.Ava_B0298 gi|75812579|ref|YP_320198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]