SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812666|ref|YP_320283.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812666|ref|YP_320283.1|
Domain Number 1 Region: 420-705
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.06e-73
Family Acetyl-CoA synthetase-like 0.0000014
Further Details:      
 
Domain Number 2 Region: 10-183
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.45e-31
Family NRPS condensation domain (amide synthase) 0.015
Further Details:      
 
Domain Number 3 Region: 192-448
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.56e-30
Family NRPS condensation domain (amide synthase) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812666|ref|YP_320283.1|
Sequence length 722
Comment AMP-dependent synthetase and ligase, partial [Anabaena variabilis ATCC 29413]
Sequence
MLNTIEGFELSPQQKRLWLLQQNSSAYRVQLAISITGNLDVAILKSAFDKLINKHEILRT
RFHKIPNFKFPIQCICDRPHIYWQEIDLTSLAWEQQQDRITELFESEKYYYLNLQSETVM
RCYLLSLSPQQHTLILTLPALCADSKTLNNLVQEISNFYSQTAHHDVNEPPIQYTQFAAW
QNEIIADTDIGREYWQEHEIDKFLGLKLPLENQATVKSEFQPQSLAIQLSPDLVAQIKAF
VQKCKTSTSEFLLTCFAILLSRITQQPDIAITVLFDGRSHESLQSAFGLFAKYLPIHFLN
ENDYNFYQALQAIAQSATEVNVRQDYFSWEQIFPELENIEERSPLFCFEFEQLQHDYINN
ELSFTIAQKYVCLEPFKIKLSCFEQADTITTEFHYNSTLFSADSIAILAGQFQTLLTNII
HQSNIAISELPILSPIEKQLLTNWNNTQTEYSQDKCIHQLFAAQVEQTPDKIAVVFQDQQ
LTYQELNSQANQLAHYLQALGVTADVPVGIYLERSLDMVVGLLAILKAGGAYVPLDPTYP
QERLAFMLADTQISVLLTHKKLVEGITQDALHIICLDEDRELIKSQNSENLANQVTADNL
AYIIYTSGSTGKPKGISLAHRPLINLLQWHNSTLLTGVRTLQFASLSFDASFHEIFATLL
SGGTLFIASEELRVDVIKLGKYISAQSIEKVIIPVVVLQQLAEFVGDFGIAPLHIEMLQH
LQ
Download sequence
Identical sequences Q3M1M7
gi|75812666|ref|YP_320283.1| 240292.Ava_C0005 gi|75812666|ref|YP_320283.1|NC_007412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]