SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812670|ref|YP_320287.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812670|ref|YP_320287.1|
Domain Number 1 Region: 1118-1605,1635-1714
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.03e-170
Family Acetyl-CoA synthetase-like 0.0000000125
Further Details:      
 
Domain Number 2 Region: 2228-2755
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.03e-162
Family Acetyl-CoA synthetase-like 0.00000000531
Further Details:      
 
Domain Number 3 Region: 11-572
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.75e-118
Family Acetyl-CoA synthetase-like 0.00022
Further Details:      
 
Domain Number 4 Region: 868-1144
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.78e-62
Family NRPS condensation domain (amide synthase) 0.069
Further Details:      
 
Domain Number 5 Region: 690-857
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.45e-45
Family NRPS condensation domain (amide synthase) 0.023
Further Details:      
 
Domain Number 6 Region: 1793-1998
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.78e-37
Family NRPS condensation domain (amide synthase) 0.027
Further Details:      
 
Domain Number 7 Region: 1989-2248
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.33e-31
Family NRPS condensation domain (amide synthase) 0.017
Further Details:      
 
Domain Number 8 Region: 1694-1765
Classification Level Classification E-value
Superfamily ACP-like 2.36e-18
Family Peptidyl carrier domain 0.0086
Further Details:      
 
Domain Number 9 Region: 597-679
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000000222
Family Acyl-carrier protein (ACP) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812670|ref|YP_320287.1|
Sequence length 2791
Comment amino acid adenylation [Anabaena variabilis ATCC 29413]
Sequence
MDKNLSQKSVEFVNLLEIIRWRSQKQPQQQAYCFLLDGEVEVQSLTYGELDNQAQRIAGL
LQAFGVKKGERVLLLYPPGLEFITAFFGCLYAGAIAVPAYPPRANQSLSRLSVIATDADS
TVALTTTTVLSYLQQHPTFNVLRLLTTDNMMADDWTNLWRQPVIDRDTLAFLQYTSGSTG
TPKGVMVSHGNLLHNQLLIKQAMQHTTATIFVGWLPLFHDMGLVGNMLQPLYLGIPCILM
SPVAFLQKPVRWLQAISQYRATTSGGPNFAYDLCVRKITAEQRATLDLSSWEVAFNGAEP
VRQATLEKFAVTFGECGFRREAFYPCYGMAETTLIVSGGCKTTPPVLQPVQSDALAQNQI
VPAKAGEIGTQILVGCGQPLADLKIVIVDPQTLSACSDRQVGEIWVAGASVAQGYWHQPE
QTESTFKAYTKDTKEGPFLRTGDLGFLQDGELFITGRLKDLIIIRGRNYYPQDIENTVQQ
SHPALEPHGGAAFSIDVDGEERLVIAQEVQRSHIRKLDIDEVIATIRAAVAVNHEIQLYG
VLLLKPGSILRTSSGKIQRYACRAKFLAGSWETIASSILEGMETGVSVADEIISEQPQLI
SYLQQQVAQILKVELSQIQPQQPLSTCGIDSLMAIELQHTVETKFGVVLAVKDFLADVSI
NQLATVILDKLSSHTIDEPVQNSHSSEYSLTYGQQALYFLQQLAPENYAYNIARAARIYG
DLNIAAFHRAWQILVDRHPALRTSFITIDGQPRQRVCQQVEVCWLQQDATTWDETYLSDR
LLEIAYRPFNLEQDPLMRLSLFTRSSQEHILLLVVHHIIADFWSLTILVDELGKLYQAEN
LPLITCQYADYVSTTAKMIASSQGEKLQAYWEQQLAGELPVLNVPADRMRPPMQTYRGDS
ISWQLGQELTNKLQNFSQQHQVTLYMTMLAVFQVLLYRYTGQEDLLVGSPTTGRSRADFA
GLVGYFVNPIVLRANFAENPTFEQFLQQVRSLVLDALTHQDYPFARLVEQLQPTRDPSRS
PIFQVMFVFQKAHLLNNEGLGGFALGEAGARLKLGELELESLPLSKRIAQFDLTLAISQV
NGVLSTSWEYNADLFDAATITRMAGHFQTLLESIIVEPSQPVGMLPMLTQQEQQQLLLEW
NATQKDYDSICLHQQFVTQVEKTPDAVAVVFEQEEITYKQLNQQANQLAHYLQGLGVKKE
VLVGVYLERSPQMVVSILAILKAGGAYLPLDPSYPRERLAFMLQDAQVAVLLTQEKFLPS
LPEHQATVVCLDKDNEVWASETIVNPVNEVTTHNLAYVIYTSGSTGRPKGVMNTHRGICN
RLAWMQETYQLTIVDRVLQKTPFSFDVSIWEFFWPLTTGACLVMARPGGHQDSAYLVKLI
QEQQITTIHFVPSMLQVFLAEPSVEACKCLRRVICSGEILPVQLQEHFFTRLDAELHNLY
GPTEAAIDVTFWACNRHSDKNIVPIGRAIANTQIYILDKHLQPVPIGVPGELHIGGVGVA
RGYLNQPQLTAEKFIVNPFSNNSNNRLYKTGDLARYHTDGSIEYLGRLDDQVKLRGFRIE
LTEIESVLTQHPDVRKAVVVMRETSAVKRQVVLNPPENNSEITDLRNFLKGELTEELLVE
STTKQLIAYCVCRHQPAPNITKLRRFLGEKLPDYMIPATFIMLDALPVTANGKLDKKSLP
NPGQGRPNLEKSFVPPHTLHEKILAQIWSEVLGIEQVGIHDNFFELGGDSIRSIQVVAKA
QERGLSFSVAQVFQHQTIYNLLTAISLNQLDSLLTEKTAAFSLISAIERDKLPNNIEDAY
PLTRVQTGIIFHSQYNLESLMYHDIFQYHLRVRFDLDLLQMAIEQLVTRHPILRTSFDLI
NFDEPLQLVHQSACIPVVVENLRSLLPAAQIQVITSWIEIEKHQRFDLSCPPLMRLFIHR
LTDETFCLTLSWHNSILDGWSNASLLTELLQRYHTLLNGEENQIESALTISYRDFVAVES
QILQSPEYQNYWQQKLQGLVIKPIPRWDKNNAKKNVQVGVLDVPISPQVSHGLKQLARLA
EVPLKNVLLAAHLKVMSLLINDEDVLTGLESNSRLEEADGEKTLGTFINTIPLRLQLEAG
TWIELVQQAFAAEQELLPYRHYPYSELQKFGNRQPLQPLLETVFNYTHFHVYQRLQDLSG
LEIIGGQGFGESNFTLRVEFNRNHITDHIQLDLECKIAEISSTQLAAIGSYYSETLIAMA
TQPFNRHEEQCLLSTAQQQQILVEWNETAIAYPENLCIHQQFEAQVVRNPDAIALVYENE
QLTYQELNRRANLLANHLQRLGVCADTLVAICVERSLEAIVGILGILKAGGAYLPLDPTY
PSEHLAFILKDTQVSLLLTQSQLLPKIPNNKAQTLCLDSEWDIIANNSDDNPSCRTTKEN
LAYVIYTSGSTGNPKGVLITHQNLVHSTNARIAYYQTPISSFLLIPSFAFDSSVAVIFWT
LCQGGKLILIKDGWQRDIWQLAQLIEQHQITHWLSVPSLYNSLLAHIEKQQLISLQTIIV
AGETCSIELVKNHQKLLPNTSLFNEYGPTETTVWSSVYNCSHHDLNNNSIPIGRPISNTQ
IYILNSHLQPVPIGTPGEIYIGGFGVSKGYLNRPELTIEKFIPDPFSKQPNARLYKTGDQ
ARYLSNGNIEFIGRIDHQIKLRGYRIELGEIEAVLQQHPQVKQAIVIARNSDSENQQLVA
YIVPSQTQDSLTNELRSFLQTKLPNYMIPSVILQIDTLPLTPNGKIDRQKLPTPEQLQPN
NELLTELLKKLNSLSETEVKTLLSQKNHQPN
Download sequence
Identical sequences A0A1W5CDZ7 Q3M1P5
240292.Ava_C0009 gi|75812670|ref|YP_320287.1| gi|75812670|ref|YP_320287.1|NC_007412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]