SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812711|ref|YP_320328.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812711|ref|YP_320328.1|
Domain Number 1 Region: 212-349
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.06e-25
Family Intein (protein splicing domain) 0.021
Further Details:      
 
Domain Number 2 Region: 2101-2251
Classification Level Classification E-value
Superfamily beta-Roll 8.5e-25
Family Serralysin-like metalloprotease, C-terminal domain 0.00072
Further Details:      
 
Domain Number 3 Region: 1182-1260,1334-1418
Classification Level Classification E-value
Superfamily beta-Roll 6.02e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0037
Further Details:      
 
Domain Number 4 Region: 1766-1914
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000126
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1690-1785
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000017
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Domain Number 6 Region: 1032-1124
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000471
Family Serralysin-like metalloprotease, C-terminal domain 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|75812711|ref|YP_320328.1|
Domain Number - Region: 1486-1567
Classification Level Classification E-value
Superfamily EF-hand 0.00184
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812711|ref|YP_320328.1|
Sequence length 2296
Comment hemolysin-type calcium-binding region [Anabaena variabilis ATCC 29413]
Sequence
MEYIFGNYDFSLPQYYYKSYYNEALELVVSKRWNDNQTIAKAALNRFMDEVAYQETKGIN
ALQDNGGPGRGYFQYEMASGGGSGGANTAINRATNWYNKNGISVPNWLNQLKGKDVDFTS
LSADQQCTIFLLDKVEDNNTYLDNIVKSYGTNNWDDTSEENWRIGHYGGKKTHEWRGEEA
SNGLMQSNIVLEELLYKLTVPQTTFPTLVTQHCFPAGVTILMSDGTYKPIEQVEIGDEVM
AFDGLGELQPRKVTQTFITPDREVVQLGNIKVTLGHHFLQPDGSFKALGEIDTNGFLVGV
TGKLIPHPGIKPVAGKHTVYNFTVEELHTYVAGDYRVHNESLSTYQPVTAAGIIGDALGG
QVASLLAGKDLSEQLIYNALGKTLGGFIGDKASYYFYPTITNGKQDVLDNVALLKRVPGA
LTTTALSIGGSQLAKSLNKLLDTNNPIAQIGVGALSTGLVNYAWNAGVIDSLKIYPGIGG
DVFAKWFGAHPNVLPDGTLERVNGNLVIKDYTFDDFTLNVANVGASMFGAYTGSQIFKNS
VGRWNILSENLQNEGAAIGSSIGGLIGSFAASATATTASVSYAVYIGQALGIGSTAIAGP
VGYAISAVISTVIGEIAGGWLNNLFGDKDYPRATYRVIYDPKLGYFTSTKSYELDGGNPT
AAKQLGDTARDLLNGLSSMIGGELKAAPNFYYGNYFEQQIYQDETSWGANVAHHDFRGRH
GFLSGQDALEAGVLEQLHLSTFLGANPYLQKVVSTFPIYPHNEKMTVQLHLSDATAQLLK
AQEYTTYANNPVLYIKTMQMLEQEQAKTSSDAIRTGIAAGVYQGKDAGARWDWQNNILYM
GYNYQPDTTPFAVTSSGTLVANYVGIPNWKTNPSQVRIIQFADNSRYVPVISSDGYNVIL
RPEAVVNWEQTKTWGDSIGLNQIAAQVLDPARISGNAIRAGVAAGTYANKEAGPRWDWQN
SILYMGYNYQPDTTLFGVTDSNVLVAPYVGVADWRYNQSKVKIIQFADGSRYVPVIAPDS
YTVLLRPEAAVNQIVVGGGQSNNYTGTSGDDVYIGKPGLDRFTDTGGNDIYLFRQGDKSK
VITDTAGYDVIRFGGGITASQIVVYRDGNDLMLGINNIGWTTGQPFAFPDVLRIVGWYTN
INNRIEQLHFEYNAQYYLETQSNGNVYIRRENKVGPPSLGNWITGSSAAEVLYGGIGPDL
IQGGTGDDLYILQPSTQTVVIDDSPANNGVVVPGGTDTLLIKTAKSDDILLTLEGQDLLV
SLKNTSYAPIRLKNWLDPNNRIEKIRFENRLEFPLVLGSDGKVSFPLVIALNGTLPGNVT
PPISSSVQIKGGLISGSNADDILYGGPGPDLMQGGGGDDVYILKPGTQADVIDDSPLYNG
VVIPGGTDTLQVETALPDNLVLTLDGQDLLVSLKNTSYVPIRLKNWLDPNNRIEKLRFDN
GLEGLLALGSDGTVKFQPFLGKGALAFGVQPTLSTNVQINRLHLAVLDLDGDGLNIINND
VSPAQYDMDGDGFLQTTGWLGGNDAFLTIDRDNSGTIDGLNELISFQTGIPGTAYIGQFD
TNRDGVLSTADGAIFSKLRLWIDSNYNGQTDLGELQQLSVAGIDMIALDTAPIDYFVNGA
ELVSTGYFIRYTGNIYKHIGELYGVDFAYTTTQQSRLEIVSANFARLNYKDDRDIWIPNN
SSLAATVTIDPREVASLTAGDNNDTVTVFTGYANDIILNGGAGNDTLTGGDGDDIITGGE
GNDVLNGGAGDDVLNVDTTDNLAALRGGTGFDTVIFDTGTTAFSFALGDANSIEFLIAND
GANTITYYGATSVVFSGLGGNDVLVSGIGNDRLEGGDGFDTLTSSLGNDVLIGGRGDDIL
DGGDGYDTAVYQGSIFTNVVNFNGSYTYVKDTVNNRNDTDRVSNVEAFSFDDGVRTWQEL
RDFEDFYRLRNPDVVAAINANKFSSGFYHYVIWGKNEGRPISFDFNEAYYRLLYKDVDAA
IKAGSVRSGLAHYISTGFAQGRQTNFDFNETYYRLLNPDVDAAIKAGTMPSALYHFINHG
YSEGRTLASQFNENYYRSANADVNAGIIAGTYKSGLDHYIKTGFAEGRMARFDAFSSTLT
HGTNNKDYIVGSANNDVLRGFAGDDIINAGNGNDTIQGGIGNDILRGEAGNDALYGDDGN
DYLIGGAGNDTMDGGAGTDTFSWDATALKSNDLMAGGLDTLLNPKGDRIDFTSNVEALLK
IGGQTLASLTADKTLTNTVTSSITFGTGNNLRFANSLLQIDLDGNGSFNATNDFQISLSD
ANSLTYKAAGDFFIVS
Download sequence
Identical sequences A0A1W5CJ44 Q3M1K4
240292.Ava_C0050 gi|75812711|ref|YP_320328.1|NC_007412 gi|75812711|ref|YP_320328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]