SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812820|ref|YP_320437.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812820|ref|YP_320437.1|
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily CheY-like 6.83e-21
Family CheY-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812820|ref|YP_320437.1|
Sequence length 127
Comment response regulator receiver domain-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MSSYTNRCILVIDDEPDLCSIVKFTLERLKSWKILTAESAQAGLMQAETQQPDVILLDLS
LCGQYRLTMLQSLKTNPTTQSIPVILFTATDPSDDSLGFDPSEFAGVILKPFNVLQLGEQ
IIEQLGW
Download sequence
Identical sequences A0A0M4T7E4 A0A1W5CMI7 Q3M195
240292.Ava_C0162 WP_011316742.1.4589 gi|75812820|ref|YP_320437.1| gi|75812820|ref|YP_320437.1|NC_007412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]