SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906255|ref|YP_320551.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906255|ref|YP_320551.1|
Domain Number 1 Region: 1-576
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.44e-185
Family Prokaryotic type I DNA topoisomerase 0.00000000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75906255|ref|YP_320551.1|
Sequence length 881
Comment DNA topoisomerase I [Anabaena variabilis ATCC 29413]
Sequence
MSTLVIVESPTKARTIRNYLPKDYRVEASMGHVRDLPQSASEIPATVKGEAWAQLGVNVD
ADFEPVYVVPKDKKKVVTQLKEALKDADELILATDEDREGESISWHLYQLLKPKVPTKRM
VFHEITQEAIKKALKDCRNIDEQLVRAQETRRILDRLVGYTLSPLLWKKIAWGLSAGRVQ
SVAVRLLVNKERQRRAFREGTYWDLKAYLEQSKSPFTAQLTTLAGTKVATGSDFDASTGR
ITAGRNVVLLTETEAVALQERLTGKTWNVSEVEERPVTRKPAPPFTTSTLQQESNRKLRL
SARDTMRIAQNLYEQGYITYMRTDSVHLSEQAIAAARNCVEQLYGKQYLSPQPRQYTTKS
KGAQEAHEAIRPAGSTFRTPQETGLGGRELALYDLIWKRTVASQMADSRQTQITVQLQVE
DAGFRASGKRIDFPGYLRAYVEGSDDPEAALEDQEVILPSLKVGDHPDCKNIEAVGHETQ
PPARYTEATLVKTLESEGIGRPSTYASIIGTIIDKGYSQLVNNALIPTFTAFAVTDLLEK
HFPDIVDPSFTSKMEQTLDDIAEGEAQWLPYLKKFYLGDQGLETLVRERESQIDAGKART
VELENLDAKVRIGKYGPYIEVENGDGVVTASIPKDLTPADLDPKQVEIILRQKTVGPDQL
GRHPETGEPIYVKIGAYGPYVQLGDKSDENPKPKQASLPKGVTPENISLETAIGLLSLPR
TLGTHPATGGKIQASLGRFGPYVVHDQGKEGKDYRSLKASDDVLTISLERALELISEPKK
TRGSTSSKSKAALRELGTHPEDDAPINIYDGPYGPYIKHGKTNVGLPEGTSVEDVTLATA
LELLSAKASTAKTTRKTSKTSTTKSKSTAKSSSTATKKKGA
Download sequence
Identical sequences A0A1W5CI71 Q3MH80
240292.Ava_0030 gi|75906255|ref|YP_320551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]