SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906259|ref|YP_320555.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906259|ref|YP_320555.1|
Domain Number 1 Region: 621-721,748-776
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000175
Family HD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75906259|ref|YP_320555.1|
Sequence length 841
Comment metal dependent phosphohydrolase [Anabaena variabilis ATCC 29413]
Sequence
MAKSLKKKSWVDAVNLGWVHEQRSSVVLAIAIVSLTGVIGHKLYNQPKLKIGTVAPQTIK
APRTASIEDKKRTEIERKAARKSLTPVLMVDVRTTAQIGQNLEKMLDQGNEIRISAGSFP
FYDTSVLSLSSQHYLRSCSDAEWQMMLVALENTGQKRLGLFLEKPSTRSLRKQENSQNLP
NTETQTSLLFPPPTVSLGQESQVQGVSLDPGQPKESISSPKTQNPEVSTNTQFVQALAEL
ATFRMTTANQNLPRLINQITQAREAYAQASVQILHVDTITTQTIYHETVLLELSDYEWTQ
TQKGIRQGAERILAQGIPAGLPQSVLQNAVTLQVQAFVPKSAESLATKLLLAVLEPNLKK
DEEQTREHAQKAASVVAPVMVEVKQGAVIVKKGKEITEWDFEVLEHYQLISRENNWLALL
KLGGLVTGGVCIFVLVETRSKCPLRQRDRLLVLLLTLSTPGVLAMGVSYTTWGAVGLLLG
SFYGRELSMTVICLLLFILPMSMEISTIGLVAGAAGGILGSYIAHRLRSREELALLGGAI
AITQGGVYLLMKVLIGAAFGSSWYLILQEAGLFTLSGLAWSVVALGLSPYLEKLFDLVTP
IRLAELANPNRPLLKRLATETPGTFQHTLFVATLAEAAAKHLGCNVELVRAGTLYHDIGK
MHDPLGFIENQMGGPNKHETEIKDPWKSAEIIKKHVSEGLVMARRHLLPTAIQAFIPEHQ
GTMLIAYFHHQAEQMAQTDPNIVVNEADFRYDGPIPQSRETAIVMLADACEAALRSLKDV
NTEQALTVLNNILRARWQDNQLIDSGLTREEMSQIAEIFVEVWQQFHHKRIAYPKMKSGK
G
Download sequence
Identical sequences A0A1W5CI88 Q3MH76
gi|75906259|ref|YP_320555.1| 240292.Ava_0034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]