SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906328|ref|YP_320624.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906328|ref|YP_320624.1|
Domain Number 1 Region: 30-251
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.09e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.077
Further Details:      
 
Domain Number 2 Region: 200-343
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000128
Family C-terminal domain of adrenodoxin reductase-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75906328|ref|YP_320624.1|
Sequence length 480
Comment hypothetical protein Ava_0103 [Anabaena variabilis ATCC 29413]
Sequence
MTTTTDLDFAAREALRLLGPDPENWVSDRPDIDHNVTIVGGSGSGSTFAFALRRAGIGRV
TVIDAALDEGHAGVWLTRARMKKLRTPKNLPGPELGVPALSFQAWYEARHGVEAYAAIDR
IPRVLWAEYLSWYRHFLNIPVRYQTKLVRIEPVAGFFRLHLEVSGVSQIETTRKIIFANG
VAGTGGPNIPPVLASLPRKLYAHTSDEIDFHELRGKTVAVLGAAASAFDAAGVALESGAK
EVHLFARRSEIASLPVIRVRGYPGAYYNYAQLPDAARWFQAWRFNQAGSTPPPDAIERVT
AFSNFHLHLSAPWREAHNQGDRIVAQVNDDVFEFDFAIAGTGYFVDPTKRPELADFAHHI
ALWRDRYEPPADQRNEQLSTYPYLGNAHEYQEKVLGSAPYLKDIHVFNPAGFVSFGLPIG
DVPSIRRDVPAIVSRISHDLFFADWSLHEARITSDNVAPDFEPSLYADAVWKEAAKVGVS
Download sequence
Identical sequences A0A1W5CII1 Q3MH07
gi|75906328|ref|YP_320624.1| 240292.Ava_0103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]