SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906336|ref|YP_320632.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906336|ref|YP_320632.1|
Domain Number 1 Region: 74-599
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.04e-140
Family Arylsulfatase 0.00000126
Further Details:      
 
Weak hits

Sequence:  gi|75906336|ref|YP_320632.1|
Domain Number - Region: 640-783
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000146
Family Clostridium neurotoxins, the second last domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75906336|ref|YP_320632.1|
Sequence length 786
Comment sulfatase [Anabaena variabilis ATCC 29413]
Sequence
MKFKSKNGNLFYRIAKAIALSLLITLLMVNGPALAATSEVLPLPLPAFKGKIGLTYKESQ
PDFPQPITAPANAPNVLLVILDDVGFGQASTFGGPVDTPNLTHLAETGLRYNQFHTTALC
SPTRAALLTGRNHHSVNTGVVEELATGYPGYTTVLPKSAATVAEILRQNGYNTAAFGKWH
NTPDFETSAVGPFDRWPTGLGFEYFYGFLGGDTNQWSPALVENTKRVDKPNKPDYHLTPD
LVDHAIAWIRNQQSIAPEKPFFAYLATGATHAPHHAPKEWIDKYQGKFDQGWDKLREETF
ARQKQLGVIPANAQLTPRPPELPAWDSLSAEQQKLYAHMAEVFAGFLAHTDYEVGRLINA
VDQLGELDNTLVIYVVGDNGASAEGGLTGSVNELQVFNAVPENLQQLLAAYDDLGSPKTF
NHFPAAWAWAVNTPFQWTKQIASHFGGTRNPLVISWGANIKDQGGIRSQFHHVIDITPTI
LEVAGITVPKEVNGVKQRPIEGTSLAYTFNNPNAPSHRETQYFEMLGNRAIYDEGWVAAA
RHGRLPWERTVKGSFDTDEWELYNIAEDFSEANNLAKKNPQKLEKLQKLFLKEAKKHNVL
PLDDRIAERFDVKIRPSLTRGRTTFTYYPGTVGIPEGSAPNLKNRSFTITANVEVPEKGA
EGVILTQGGRFAGWSFFLEDNKPTYVYNYANTARYTIQSPEKLPSGKSTIRFNFDYDGGV
GAGGIGKLFINDQQVAEGRVDKTIAYRLALDETFDVGRDTGTPVVDTYQVPFNFTGNLQQ
VSLDLK
Download sequence
Identical sequences Q3MGZ9
gi|75906336|ref|YP_320632.1| 240292.Ava_0111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]