SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906659|ref|YP_320955.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906659|ref|YP_320955.1|
Domain Number 1 Region: 13-333
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-51
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 357-587
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.15e-41
Family Pectin methylesterase 0.009
Further Details:      
 
Domain Number 3 Region: 553-672
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.65e-17
Family Galacturonase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75906659|ref|YP_320955.1|
Sequence length 674
Comment serine/threonine protein kinase [Anabaena variabilis ATCC 29413]
Sequence
MSLCINPQCSKPQNPDNVLFCQNCGSELLLEGRYRVVSVLGGGGFGKTFAVNDTRTQTAK
VLKVLINNHPKAVELFQREAEVLALLNYPGIPTVEANGYFVYFPRNSQEPMHCLVMEKIE
GLDLGQYLRQRDYRPIDQKLALQWFKEVMIILHQVHQQGLFHRDIKPSNIMLRADGRLVL
IDFGTARSVTGTYIAKQAVGQVTGVISAGYTPSEQINGQAVQQSDFFALGRTFIYLLTGK
EPSDPTIYNYLNDELRWRDGLLSSGSNSVTPTVGDRPNILPQFADLLDQMMERLPAQRPQ
NTHIILQRLADIEKSLQPPPPPPPKPKGWTRRRLIAVVGFSSLGLTGALALSRLLPKTTL
IVSQEGGGDYKTISAAIENAQPGMRILVRPGLYQESLVLDKALKIIGDGVKAEIIIESKD
AGCLVVKTDQAEVRGLTFRSRVGTENKQYFAVDISQGQVILADCDITSDSLSGIGVHGAT
ANPVIQKCQIHDGKQSGIYLYENSRGTIEDCDFFGNTTTEITVDAAQPIIRRCKIHQDKE
GGILFRNQAQGIVEDCDIFNNNLSGIEIRDSSNPTIQKCRIHDNQQGDGILVHLNGRGTV
EDCNIFSNGFSGVEIRDRGNPVIRRCSINKNKYYGVYAYKNSTGTVENCDLTGNIRSAIN
VDETSQLQRSGNVE
Download sequence
Identical sequences A0A1W5CFV9 Q3MG26
240292.Ava_0434 gi|75906659|ref|YP_320955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]