SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906745|ref|YP_321041.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906745|ref|YP_321041.1|
Domain Number 1 Region: 44-162
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.44e-20
Family Tricorn protease N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75906745|ref|YP_321041.1|
Sequence length 172
Comment WD-40-like protein beta propeller repeat-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MIKRIFIFACTTLLGGCFGYPRLVSYPFDPGGRSINSLASELNPQISGRYIVFTSDRRGS
QDVYMFDTLTQNLVDLPGLNALDTIASHPSASADGRYVVFAASRQGRSAIFIYDRETRQL
RNLTNNLQAEVRNPTISADGNAIAFESSNNGQWDVLVYNRSGQPVNVPQDPR
Download sequence
Identical sequences A0A1W5CPE7 Q3MFU0
gi|75906745|ref|YP_321041.1| 240292.Ava_0522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]