SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906806|ref|YP_321102.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906806|ref|YP_321102.1|
Domain Number 1 Region: 856-1041
Classification Level Classification E-value
Superfamily beta-Roll 1.31e-29
Family Serralysin-like metalloprotease, C-terminal domain 0.00032
Further Details:      
 
Domain Number 2 Region: 654-722,749-831
Classification Level Classification E-value
Superfamily beta-Roll 4.71e-28
Family Serralysin-like metalloprotease, C-terminal domain 0.0008
Further Details:      
 
Domain Number 3 Region: 555-654
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-26
Family Dystroglycan, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75906806|ref|YP_321102.1|
Sequence length 1055
Comment hypothetical protein Ava_0583 [Anabaena variabilis ATCC 29413]
Sequence
MANTAPLLNNTGNLTLSFITEDIPVTSNTGTLVSEIIGNSISDPDASALKGIAVTFVDNS
NGVWEYTLNNGTSWNAFGTPLLNAARLLPSNANTKIRFRPNANFSGSADINFYAWDQTTG
TSGNTANILAGKGGTTAFSTDYEGASITVTSVNDTAPTLNAGTLTLATINEDTPLVSNRG
SLLADLVRGLISDSDANPQGIAVTGADNSNGSWQYSLDGGANWLNFGAVSDSSATVLLPS
IRLYDGSLIGSPTSQGWLKFGASPAITLPILGNVLGVGGTQSQISGGTQLNSNTTPASSL
AGFTASTGTSGYSNYNGYAPVLFNQSFPALDPVKGFTISFDVKINSETHTSDDNGDGIQD
RAGFSVIVVTSDKTKAIELGFWTDEIWAQNASPLFTHSTTERAFRNTSTAVTHYNLVVEN
NTYKLFAPDSSTPILSGNLRDYTAFNHTTAAPSPINSLPFDPYETPNFLFLGDNTTSARS
SIDLTRVELQTNTRVRFVPNADYNGQANLTFRAWDGSNGVASGTTGVNASVNGNATAFSS
NTQTVGITINSVNDAPIVANSISNQTAITGTAFNFQIAANTFADADSGDTLTYSATRSDG
SPLPSWLSFDADTGRFTGTPTTDNLGSISLRVTATDTTNLSVNTIFNLEIRRPDNIINGT
ANNNTIIATSAKDIFDGGDGGDIFITNIANLSQNDILNGGNGQDTIIIQGGINTDTISFD
LSNVNNQLASILGTTITNVETFDLRSFAGTVTFTGGSGNDVVYGGVGNDTLTGGAGDDNL
NGGAGDDTLIGGDGNDILTGGSGTNTLTGGAGNDRYYIDNASDVIQEGAGAGQDEVFATV
SYTLAANVEALTLRGTAIQGTGNSSNNNIRGNNANNILSGEDGNDNLTGNAGNDVLIGGR
GNDTLNGGIGNDELIGGAGSDRLFGGAGADYFSFGSQGNPFNSGDFGIDTIADFAVGVDD
IKLDKVSFSALTSVVGNGFSVSSEFASVSNDTLAATSNGLIVYSLGSGRLFYNQNGSAAG
FGTGAQFATLSGTPILSADDFFIFQSVQEPAKKIA
Download sequence
Identical sequences A0A1W5CGW4 Q3MFM9
gi|75906806|ref|YP_321102.1| 240292.Ava_0583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]