SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906837|ref|YP_321133.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75906837|ref|YP_321133.1|
Domain Number - Region: 28-68
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0188
Family Histidine biosynthesis enzymes 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75906837|ref|YP_321133.1|
Sequence length 167
Comment hypothetical protein Ava_0614 [Anabaena variabilis ATCC 29413]
Sequence
MKSLIYGSLSALILSTSAVAIATPVKHEQSGSNINKLSQVALNVNVPHITNSGVRNGNHF
IRLAVVGMSLQDLMISLPSQMERFNGVRIRDESGKAISAKTEISKENLSITFDEPVTSGA
SVEVELTGVRRNSLGQDVLLYGVTARRVGLTGDIPVGTARIDIYDKN
Download sequence
Identical sequences A0A1W5CGT2 Q3MFJ8
gi|75906837|ref|YP_321133.1| 240292.Ava_0614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]