SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906930|ref|YP_321226.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906930|ref|YP_321226.1|
Domain Number 1 Region: 87-166
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.57e-24
Family Translational machinery components 0.00033
Further Details:      
 
Domain Number 2 Region: 15-83
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.83e-19
Family Ribosomal S5 protein, N-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75906930|ref|YP_321226.1|
Sequence length 174
Comment 30S ribosomal protein S5 [Anabaena variabilis ATCC 29413]
Sequence
MATGRRKANRTKKEETNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNERGQVGVGVGKA
SDVIGAVKKGVADGKKHLIDIPITKSNSIPHPIDGVGGGAKVMMRPAAPGTGVIAGGAVR
TVLELAGVRNVLAKQLGSNNPLNNARAAVNALSTLRTLAEVAEDRGIAIEKLYI
Download sequence
Identical sequences A0A1W5CGM5 A0A1Z4KLH1 Q3MFA5 Q8YPJ5
103690.all4199 240292.Ava_0707 gi|75906930|ref|YP_321226.1| gi|17231691|ref|NP_488239.1| WP_010998337.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]