SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906982|ref|YP_321278.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906982|ref|YP_321278.1|
Domain Number 1 Region: 11-162
Classification Level Classification E-value
Superfamily Ferritin-like 4.55e-50
Family Ferritin 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75906982|ref|YP_321278.1|
Sequence length 163
Comment Ferritin and Dps [Anabaena variabilis ATCC 29413]
Sequence
MASQGTINNVNIGIDEANRAKIAEGLSRLLADTYTLYLKTHNFHWNVTGPMFQTLHLMFE
TQYTELALAVDLVAERIRALGYPAPGTYSEYAKLSSIPETSGVPKAKEMIRLLVEGQEAV
VRTARSIFPVVDEVNDEPTADLLTQRMQVHEKTAWMLRSLLEE
Download sequence
Identical sequences A0A1W5CGC4 Q3MF53
gi|75906982|ref|YP_321278.1| 240292.Ava_0759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]