SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907126|ref|YP_321422.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75907126|ref|YP_321422.1|
Domain Number - Region: 18-25,58-109
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0247
Family Di-heme elbow motif 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907126|ref|YP_321422.1|
Sequence length 121
Comment hypothetical protein Ava_0903 [Anabaena variabilis ATCC 29413]
Sequence
MMMMMMTESMTTEMQACMKACMDCHKMCMETMTYCMTKGGMQMDMSMMGMMRDCSEMCMM
CVNMMMGGSEFMGRTCMLCAEMCDRCAMACEQMSDDQMMMDCAMACRKCAEACRSMQMMP
A
Download sequence
Identical sequences Q3MEQ9
240292.Ava_0903 gi|75907126|ref|YP_321422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]