SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907143|ref|YP_321439.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907143|ref|YP_321439.1|
Domain Number 1 Region: 5-280
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.86e-48
Family Bacterial dinuclear zinc exopeptidases 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75907143|ref|YP_321439.1|
Sequence length 282
Comment peptidases M20 and M28 [Anabaena variabilis ATCC 29413]
Sequence
MNLKARLHNHLIQVARERDPYLATAGHFFVQEYIRQEFAQWGSVEIHTFQVGNKSFNNLI
LNLPSQSIGKKQELPPILIGAHYDGVPGTSGADDNATGVVVLLELARKFAAAPAKYPLRL
VAFDMEEYGLLGSTDYAGLLRQQQQPLRLMMSLEMLGYRDCTPGSQRYPAPLEKFYPNTG
DFIALIGNLRTIPDLIGMSRHIRKAGISSQWLPVPNRGLIVPQTRLSDHAPFWDAGYPAI
MVTDTAFLRNPHYHKPSDAIATLDLDFLTGVCEGLEISIRRL
Download sequence
Identical sequences A0A1W5CKT2 Q3MEP2 Q9ZEK2
gi|75907143|ref|YP_321439.1| 240292.Ava_0920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]