SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907303|ref|YP_321599.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907303|ref|YP_321599.1|
Domain Number 1 Region: 804-1189
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.9e-123
Family PFOR PP module 0.000000015
Further Details:      
 
Domain Number 2 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.12e-76
Family PFOR Pyr module 0.0000000489
Further Details:      
 
Domain Number 3 Region: 420-678
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.15e-76
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000037
Further Details:      
 
Domain Number 4 Region: 260-418
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.02e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000831
Further Details:      
 
Domain Number 5 Region: 675-847
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.95e-23
Family Ferredoxin domains from multidomain proteins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907303|ref|YP_321599.1|
Sequence length 1190
Comment ferredoxin (flavodoxin) oxidoreductase [Anabaena variabilis ATCC 29413]
Sequence
MSQTFATIDGNEAVARVAYKLNEVIAIYPITPSSAMGEWADAWMAEGRPNLWGTVPSVVQ
MQSEGGAAGAVHGALQTGSLSTTFTASQGLLLMIPNLYKIGGELTSMVVHVAARSLATHA
LSIFGDHSDVMAARGTGFAMLCSASVQESHDFALIAHAATLDTRVSFLHFFDGFRTSHEV
QKVELLSDDDVRSLINEDKIFAHRARALTPDSPLLRGTAQNPDVFFQAREGANPYYNACP
EIVQGIMDKFGERTGRYYQIYEYHGASDADRVIILMGSGCETVHETVDYLNARGEKVGVL
KVRLFRPWDVERFIQALPDSVQAIAVLDRTKEPGSAGEPLYQDVVTAIHEGWGVGGKLPT
VVGGRYGLSSKEFTPAMVKAVFDNLAQATPKNHFTIGINDDVTHTSLEYDPSFSTEPDNV
VRAMFYGLGSDGTVGANKNSIKIIGEGTDNYAQGYFVYDSKKSGSMTVSHLRFGSQPIRS
TYLIDQANFIGCHHWGFLERIEVLKAAAQGATILLNSPYDAGAVWENLPLKVQQQILDKQ
LKLYVINANQVARDSGMGGRINTIMQVCFFALAGVLPEAQAIAKIKQAIEKTYGKKGVEV
VRMNLQAVDQTLENLHEVKIPIEEKGKWIDEEALLSNQSPFPTSAPKFVRDILGKIMVWQ
GDDLPVSTLPPDGTFPTGTAKWEKRNVAQEIPVWDTDVCVQCSKCVMVCPHAAIRAKVYQ
PGELENAPPTFKSVDAKDRDFANQKFTIQVAPEDCTGCAICVNVCPAKNKSEPSLKAINM
ANQLPLREQERDNWDFFLNLPNPDRRKLKLNQIRQQQLQEPLFEFSGACAGCGETPYVKL
LTQLFGDRAVIANATGCSSIYGGNLPTTPWTKNNEGRGPAWSNSLFEDNAEFGFGYRLSL
DKQGEFAAELLQQFSAEVGDNLVQSILNAEQKTEADIWEQRERIALLKQQLEGIQTFDPS
IKSKIQNLKSLADYLVKKSVWIIGGDGWAYDIDFGGIDHILASGRNVNILVMDTEVYSNT
GGQSSKATPKAAVAKFAASGKPAQKKDMGLMAMNYGNVYVASVALGAKDDQTLKAFLEAE
AFDGPSIIIAYSHCIAHGINMTTGMNQQKALVESGRWLLYRYNPLLQQQGKNPLQLDMRS
PTQSVEQSMYQENRFKMLTKSKPELAKQLLEQAQAEVDARWQMYQYLANR
Download sequence
Identical sequences A0A1W5CNU8 Q3ME82
240292.Ava_1080 gi|75907303|ref|YP_321599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]