SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907612|ref|YP_321908.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907612|ref|YP_321908.1|
Domain Number 1 Region: 35-154,181-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.96e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.013
Further Details:      
 
Domain Number 2 Region: 537-637
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000022
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 3 Region: 340-494
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.032
Further Details:      
 
Domain Number 4 Region: 641-721,767-796
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000534
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75907612|ref|YP_321908.1|
Sequence length 1033
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MSRHCIKIGISIILGVGAITGIEHPSNAEIIQDSTLPENTNVTVNFGKEGDSTFIINGGT
AIGNNLFHSFSKFSLLKGQNAYFNSTDNIQNIFSRVTGGEVSNIDGLITARSRVNLFLIN
PNGIIFGPNAQINIQGSFVASTAHSVRFAEGGEFIAKTASVTPLLNVTTPIGLQYGANSG
SIQLQGESIHQPSRLQVEGNQTLALIGGDVILGNANLSTIKSEGRIELGSVASASLVGIK
SVSSGFLFKFDGVSEFGDIQLSSGTNINSLGDLNLTGKNIVLQDASLNVFNNLTVNAQES
IQLIDRSAIDTRSSNNSPGNHTINTRRLLLSNQSFIGINGGNLEVNASDVVELTSDLKGT
PSRIYATTSDGDAANGNLTINTGDLLVENGSQIITNSSTAFSGIIPLNVQTKASLTINAA
NSVTLRGSSLDEIYSSGVFSQTDGDGKAGDLTINTRVLRIEDGAQVIARNLSVGKGGNLT
VNASDKVLIIGTSPKGSIPGNWPNDSELDEQVPRAVGPLKELLITGVLRRDSLPSGIFTD
SVSSGDAGMITINTGELTAQNGGRISADAFSAGKGGDLMISATDKVELIGTAVNGVASGL
FTRTGSSATGNAGSLTIVTGNLLVKDGAQVSVSTFGTAKGGNLLVQAAEGIKLIGVSQRN
IASGLFAQANRYATGDAGSLKIDTSTLLVRDGAQVSASTFGAGKGGDLFVQASDIKLIGT
AADASFSSGLFTVATANSTGSAGKLTVNADVLDIEQGAGVGVQSSGKGSAGNLNINAHRI
RLDDQAFISADTRDNGSDPNRSQANINLRSRNLILSRGSSITTNATGSNVIGGNIDIDTN
TLVAIQNSDISANSADFRGGRININAQNIFGTKFRNQRTPNSDITATGASPELSGAVEIT
TPDVDPSQSLSQLPSEAVDVSNQISQECRIDEATAQRQNQFIITGRGGVPTNPYETLDNT
AIITDWVTVNDVNTVAHKENNFAQEENTVANSIVEAQGWVYDTQGNLVLTAEATKITGHG
SGLTTDFCQVNKG
Download sequence
Identical sequences A0A1W5CPX2 Q3MDC3
gi|75907612|ref|YP_321908.1| 240292.Ava_1390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]