SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907614|ref|YP_321910.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75907614|ref|YP_321910.1|
Domain Number - Region: 182-231
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00902
Family PspA lactotransferrin-binding region 0.008
Further Details:      
 
Domain Number - Region: 356-404
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0113
Family Di-heme elbow motif 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907614|ref|YP_321910.1|
Sequence length 413
Comment hypothetical protein Ava_1392 [Anabaena variabilis ATCC 29413]
Sequence
MFARIRRLVNQFFSKSRKINNEPLNRVSLTVIILIDIFILVNVFTGLDDISRWHLSPSQA
YPCYSQWQTYRTETNKDKDYEIIRRSLLGNISNLPNQKQTYQQNEIDHLGKVSSTCLRYG
EYIDKIKTPQNQQAIKGIDQRQAQISNLKQSNNRIRAQYDSTLLDKLAGQAPGQSINQVP
AEKAKQELDKNNLQISQLEKEISNLKNQLLTQPESNSLIAFLQNRGEFATVEQGYKQASF
WYPSIQLAFQSLFLLPLIFAALLVHQFSQRRGYGLIALISWHLLVIFFIPLVLKIFEFLQ
VGAIFQFAFDIISAVFGSLLFLVSYVYILLIPLIGFGIIKFFQKIVLNPKLQAVNRIQKS
RCVKCAKKIRANDAYCPHCGYYQYVECQNCHNLTYKHLPHCKHCGTLQDIGDL
Download sequence
Identical sequences A0A1W5CQD0 Q3MDC1
gi|75907614|ref|YP_321910.1| 240292.Ava_1392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]