SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907831|ref|YP_322127.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907831|ref|YP_322127.1|
Domain Number 1 Region: 184-740
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.16e-94
Family Acetyl-CoA synthetase-like 0.0002
Further Details:      
 
Domain Number 2 Region: 1002-1226
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.08e-37
Family Tyrosine-dependent oxidoreductases 0.00027
Further Details:      
 
Domain Number 3 Region: 759-988
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.87e-25
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.081
Further Details:      
 
Domain Number 4 Region: 1321-1393
Classification Level Classification E-value
Superfamily ACP-like 1.1e-18
Family Peptidyl carrier domain 0.0026
Further Details:      
 
Domain Number 5 Region: 16-104
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.000000000183
Family Acetyl-CoA synthetase-like 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|75907831|ref|YP_322127.1|
Domain Number - Region: 1290-1336
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.0458
Family Acetyl-CoA synthetase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75907831|ref|YP_322127.1|
Sequence length 1419
Comment AMP-dependent synthetase and ligase [Anabaena variabilis ATCC 29413]
Sequence
MQLNNYSQNLESPNSENFIYRDIEIAILSSLTVDDCVVIEKQTKNLESELVAYIVPSGLF
VPEQLLSHLQAILPRELVPTAIVTISTIPLTSTGQVDEVTLASLEVIDSDLIYRAQKQLE
SLSAIERVAVVAEPLVTNVPPVHLQDLLGETEAIAFEDSQQNLQATIPRQNVENQETFSS
KNLAISQGEPLPQSENAPKTLKELLQKATQNSTKNIIYIQPDGSEKFQSYREVWQDAQRI
LSGLRKLGLKPQDKVIFQLEDNQDFICGFWACVLGGFVPVPISIAPTYELANSIASKLQN
TWQMLDKPFVLTNAALAPKIDDLSKFLKLENFQFAIIDQLRECEPDLNLYQSQPEDLAIL
FLTSGSTGIPKCVMLNHHNLLSMTTGLILMGHFSSQESVLNWMPLDHVGALVSLSIMAVS
LGCQQIHVPTNLIVQNPLLWLDLIDKHQATISWAPNFAFSLICDALGDSIYGKMGEQYRP
ENNQKHWDLSSMGFVINAGEPIVTKIARNFLKLLRPYGLPTNAIHPAFGMSETSSGITYS
DSFSLESSSDDSLFVELGLPLAGASLRIVDENEQIVTESTIGRLQVQGASVTSGYYQNPQ
ANQEIFTFDGWFNTGDLGFLHQGRLTITGRQKDVIIINGLNYYCHEIEAAVEEIKEVEVS
YTAACAVRQPGIHTDKLAIFFHTAIVDDTSLLTLLKEIRTSVVNKVGINPDYLLPVEPEA
IPKTAIGKIQRSQLSRRFNTGEFKSVIKHVDILLGNANTIPDWFYRQVWQPKNPITFNSS
LNLTNCTLVFLDAFGLGTYLCQILSERNLQYITVSPGEDFRKINHSHYTITPGQAKDYKL
LLKSLATDNITIGQILHLWNYDQYLGEITSIEALEAAQEKGIYSLLFLVQALAKVQGVDS
PIQLLFISSYVQSISSDDPIAYEKSPVLGLLKTIPQELPCLNCRHIDLPFAEVEKTGTYL
LQEMQVSSKEREVAYRNGQRFIPRLEKVDFTSKPKSPISFKHRGTYLITGGLGGIGIEIA
RYLLKHYQARLLLVGRTPLIHHGKEDVITQHQKAYQELSQLGGEVIYEAVDICDLNHLQI
IVEKAQSQWCKNLDGVLHLAGTSHEQMILEETQENLAAILRPKVFGAWTLHQLVKDNKGS
IFINFSSVNGFFGSTAVGAYAAANSFLDGFSHYQNSHSELTSYCLSWSMWHEIGMSQGYQ
LKNLIRTKGFYVMSSSQAISSMLATLQHQQTHLLIGLDGSNQNIQLWQSQAFNLQKLSAY
FTTHSSDDIFKLQHLTVEDRFGNSCNCNLVKLKEIPLTESGAIDKNKLIRQFTGQDTGTH
VAPRNKLEQQIADIWEQVLGRPVFSVHHNFFELGGNSLVGTQVISRLRNTFSIDLSLQSL
FKLPTVAELASNIEVIEILMKNEYAIANDIAEEYEEGCL
Download sequence
Identical sequences Q3MCQ4
240292.Ava_1609 gi|75907831|ref|YP_322127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]