SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907832|ref|YP_322128.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907832|ref|YP_322128.1|
Domain Number 1 Region: 496-1068
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.83e-168
Family Acetyl-CoA synthetase-like 0.00000000349
Further Details:      
 
Domain Number 2 Region: 262-527
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.56e-66
Family NRPS condensation domain (amide synthase) 0.041
Further Details:      
 
Domain Number 3 Region: 80-255
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.33e-52
Family NRPS condensation domain (amide synthase) 0.012
Further Details:      
 
Domain Number 4 Region: 1049-1120
Classification Level Classification E-value
Superfamily ACP-like 4.84e-22
Family Peptidyl carrier domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75907832|ref|YP_322128.1|
Sequence length 1142
Comment amino acid adenylation protein [Anabaena variabilis ATCC 29413]
Sequence
MNKMTVFAFLSSLNRLGIKVWIEDKQLRYRAPKGVMTPNIKQDLMEQKNEILNCLQQSIN
TKKLAFEPILPTERNHHLPLSFSQERMWFLHQLESGSGAYTIAFAVRLEGNLNIKALEQA
IGEIVQRHEVLRTRFEIKNNKPVQVIDPKITLALPVVDLKNVVDPWQQVEELAIKEACKA
FDLANDSVLRVMLWTVSQNDYALLFAIHHIAADGWSKGVFINELSAYYRAIAKGDSVVLP
ELPVQYADYSLWQRHHLTNQTLEHQLSYWKQQLAGASPVLELPTDHPRPVIQTFRGGIER
FQIDGKLTQQLQKLSQGSGSTLFMTLLAGFVVLMSRYSGQRDLVVGSPIANRNRQEIEGL
IGLFVNTLALRFDLSPEQTFNTLLEQVKQVTQDAYENQDLPFEMLIEELHLERSLDRSPL
VQVMFALQNAPKNSWDLPNLKVEEMPWELDAVRFDLEVHFWEVPQGLEGICYYSSDLFDG
ATIARMMKHFQNLLANIVTNPQQSVNQLPLLTAPEKQQLLIEWNNTDTDYPRNQCIHHLF
AAQVQKTPDAIAVVYGEQQLTYHQLNTQANQLAHYLQKLGVKPGVLVGICVERSVSMIVG
LLAILKAGGAYVPLDTEYPQERLAFIIEDTQLSVLLTTQKIAETLPQDQGRVVCFDTDIE
AIALESQQNPTVEVTADHLAYVIYTSGSTGTPKGVVVDHKAVNRLVINTNYINIKPTDVI
AQAANCTFDAATFEIWGALLNGARLLGVRKDLALSPKQFATFMRSQDISVLFLTTALFNQ
IAQAVPSAFNSLRYLLFGGEAVDVKWVREVLNNGAPQQLLHVYGPTENTTFTSWYLVQDV
PEDATTIPIGRPIANTQIYLLDSQLQPVGVGVPGEIYIGGDGLAREYLNRPELTQQKFIP
NAFSSDSHSCLYKTGDKARYLSDGNIEFLGRIDHQVKIRGFRIELGEIETVLSQHPLLKE
SVVVVREDSPGDKRLVAYLVPAVNDYTHDNQKLVPQVREYIQQKLPNYMVPQAFVLLHAL
PLTPNGKVDRRALPQPDIATRNLSTGTVLPRTPIEAQLAQIWSEVLGVETIGVKDNFFEL
GGHSLLATQVLSQINSTFGLDLSIQIMFESPTVAGIAAYIEVVNLVTQNLSNKEVSSEVV
EF
Download sequence
Identical sequences Q3MCQ3
gi|75907832|ref|YP_322128.1| 240292.Ava_1610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]