SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907834|ref|YP_322130.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907834|ref|YP_322130.1|
Domain Number 1 Region: 13-131,161-387,419-440
Classification Level Classification E-value
Superfamily Thiolase-like 1.5e-79
Family Thiolase-related 0.00048
Further Details:      
 
Domain Number 2 Region: 546-679,739-837
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 7.32e-70
Family FabD-like 0.00016
Further Details:      
 
Domain Number 3 Region: 1044-1269
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.63e-30
Family BC2162-like 0.085
Further Details:      
 
Domain Number 4 Region: 1331-1401
Classification Level Classification E-value
Superfamily ACP-like 8.9e-20
Family Peptidyl carrier domain 0.0038
Further Details:      
 
Domain Number 5 Region: 677-738
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000432
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907834|ref|YP_322130.1|
Sequence length 1424
Comment beta-ketoacyl synthase [Anabaena variabilis ATCC 29413]
Sequence
MTIDSGYDNHEFNNSEIAIIAVAGRFPGAKDIASFWQNLRDGVESISRFTDEELLNSGVS
SDLLNSPNYVKAGSVLSDIELFDANFFAYSAKEAELIDPQQRLFLELAWEAVETAGYDPQ
TYHGLIGVYGGVGMNRYFLNNLYPHHQLLATIDPIQLGFSNDKDFLPTRAAYKLNLTGPA
VNIQTACSTSLVAIHIACQSLLNGECDMALAGGVTLSIPQKIGYLHQEGMILSPDGHCRA
FDAQAQGTIAGSGAGIVVLKRLKDAISDRDHICAIIRGSAINNDGAVKVGYTAPSVSGQA
AVIAEAQAIAGVDAETISYIEAHGTATPLGDPIEIAALTQAFHQTTDKKGFCAIGSLKTN
LGHLDTAAGVAGLIKTVLALQHKMLPPSLHFETPNPKIDFANSPFYVNTTLKEWETNNSP
RRAGVSSFGMGGTNAHVILEEAPIQGKSQNTLRECQGRTKFKNKYLLLCLSAKTGSALEK
ATGNLVAYLKEHPEVNLGDVAYTLNSGRRGFNYRRMLICQDLEDAVKGLESKQVATNYTE
ITERPVVFMFPGQGSQYVNMGREIYETEAVFKEQVDYCSEFLKPLLGLDLRDIIYPSDDK
IDAASKQLEQTGIAQPAIFVIEYALAQLWQSWGVKPQAAIAHSIGEYVAATLAEVFSLED
ALSLVTARGQMMQQLPTGAMLSIPLPVDQVQSLLGTELAIAAINVRSQCVVSGSIAAINT
LQNQLAAQGIECRRLHTSHAFHSHMMEPILEAFAERVQQVTLNPPKLPYISNLTGTWITV
TQATNPEYYAQHLRSPVLFAQGVEKLLATPEQVLLEVGPGHTLSTLVKRNPGKVATQTVL
TSIRHPQEKQSDIRVLFNTFGQLWLAGVKVDWLGFYSQDEYYRLPLPTYPFERQRYWIDP
PEKTAWGQLPTLPPTSQLWNLLTQAGQKQASVINAELNESTYQENKQWLDSLCTAYINTA
LRQLGAFNHSQEKYALENFWEQYHISPRYQQLFSRWLQILIEQGQLQQQEGLFTGLVPCS
QNYIDEHLAEVRARFAASSLVDLDLVQRCGENLAAIVTGEQEPLEIFNELVYQKENKASY
SESPLINYYNSILRSSLEQIVKSLPSSVHLRVLEIGAGTGVSTQALLPLLPPQQTNYTFT
DIGSGFLTQAQQKFQEYPFVEYRLLDIDKPPTEQGFEQYSFDVIIATNVLHATQNIDQTL
HHVRSLLAPGGFLLVWEITQPKIDFDISWGLLLKPLDDQRRDPGQPFIIKDQWFAALQAQ
DFVQVAAFPENEAFEHQIIMAQAAVSTAFSSKSGQQETKTKSNISLPIKPDSLQPEKLST
LHSRPNLANSYIAHRDEIEQKIADIWQESLGINQVGIHDDFFELGGDSLIAVQILSRLRN
TFAIGLNVASLFASPTIAEIALKIGKSLEPDTNSSAFDREEIAI
Download sequence
Identical sequences Q3MCQ1
gi|75907834|ref|YP_322130.1| 240292.Ava_1612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]