SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907842|ref|YP_322138.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907842|ref|YP_322138.1|
Domain Number 1 Region: 341-675
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.37e-45
Family Patatin 0.0000458
Further Details:      
 
Domain Number 2 Region: 9-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-26
Family Laminin G-like module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907842|ref|YP_322138.1|
Sequence length 686
Comment patatin [Anabaena variabilis ATCC 29413]
Sequence
MINLANTQTVLKFDGIDDYIDFGKNDIGGVFAQGSSCFTVSGWINPHKLTEKSTSYGTRN
VFFARSSDRYSDNFEFGISETGSLDIFIDETISKGIRTFGNGELTIGQWHFFAIVFNSGQ
ITVYLDDHEYNDSLRGSSLNKATSSVTLGATLHKQVYFTGQLANISVWNYPCTQVQIKTH
HCGLIVGDEPGLVAYWKLDEGQGTTVKNKAGKSYQGNFRGNPSWDLAQIPFAAPLSSQDD
IQEDVQFEIGIIAETSISTLTTDLLAATVPLVSNNEDQTIEIQYPEINSEKSEIIANLIN
LPSHEEASKTDQTEVLVNSQQLQTFIQAESPETMNTKSRPRYKILSIDGGGIRGIIPALL
LAEIERRTQEPIFSLFDLIAGTSSGGILALGLTKPRLNSSEELPLAEYTAEDLVQLFLEY
GVEIFYEPLFERLLGPLEDIFLQPKYPSTSKEEILRQYLGKTPLVNNLKEVFVTSYDIEQ
RIPVFFTNQLEKQQIESKNSHNLCGNVSLLDAALATSATPTYFAPHRIVSPENSAIAYTL
IDGGVFANNPAHLAILEAQISSKRKAQTVLNQEDILVVSLGTGSPTSAYPYKEVKNWGLL
QWGRPLLNIVFDGGSGVVSGELEQLFEPSDKEAKSFYYRFQTLLDAELEAIDNTKLQNTR
QLQAIAHKLISEKSQQIDELCELLLG
Download sequence
Identical sequences A0A1W5CBM5 Q3MCP3
240292.Ava_1620 gi|75907842|ref|YP_322138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]