SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907869|ref|YP_322165.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907869|ref|YP_322165.1|
Domain Number 1 Region: 17-108
Classification Level Classification E-value
Superfamily ACP-like 1.96e-18
Family Acyl-carrier protein (ACP) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75907869|ref|YP_322165.1|
Sequence length 128
Comment phosphopantetheine-binding protein [Anabaena variabilis ATCC 29413]
Sequence
MQLKDSNSKPSTNNAVDTIQEWLVNQIATQLSIKAQTIKVTEPLTRYGLDSIDSVTIVGE
LEDWLDAELPPTLLWDYPTIEKASQYLVNEVGVTPAETTTAEPVANQPKEEAPKEKAWGG
LWNKISGS
Download sequence
Identical sequences A0A1W5CBI6 Q3MCL6
gi|75907869|ref|YP_322165.1| 240292.Ava_1647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]