SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908032|ref|YP_322328.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908032|ref|YP_322328.1|
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily IpsF-like 3.14e-66
Family IpsF-like 0.00000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908032|ref|YP_322328.1|
Sequence length 165
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Anabaena variabilis ATCC 29413]
Sequence
MTMSIRIGNGYDIHRLVSDRALILGGVHIPHELGLLGHSDADVLTHAIMDAMLGALSLGD
IGHYFPPTDPQWAGADSLVLLNQVNELIRAQGWRIGNIDSVVVAERPKLKPHIKTMRDKL
ANVLQLEPNQIGVKATTNEKLGPVGREEGICAYAVVLLVSSDPVN
Download sequence
Identical sequences A0A1W5CCN0 Q3MC53
240292.Ava_1811 gi|75908032|ref|YP_322328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]