SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908147|ref|YP_322443.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908147|ref|YP_322443.1|
Domain Number 1 Region: 39-292
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.53e-84
Family Tryptophan biosynthesis enzymes 0.0000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908147|ref|YP_322443.1|
Sequence length 296
Comment indole-3-glycerol-phosphate synthase [Anabaena variabilis ATCC 29413]
Sequence
MQIRRRQPNPAINVSILRYQVAVPDAKPQHILEEIVWQKEVEVDQMREKLPLLELQKKAR
IAPPTRDFFAALKQGRTTPALIAEVKKASPSKGVFREDFDPVAIALSYQQGGASCISVLT
DEKFFQGSFDNLTKVRAAVDLPLLCKDFVIYPYQMYLARIQGADAVLLIAAILSDQDLQY
FIKIAKALNMAALVEVHNLEELDRVLALDGVSLVGINNRNLEDFSVDLQTTCQLLAARGS
QLQERNILVVSESGLHNPEDLSLVSQSGASAVLIGESLVKQPDPELAIANLFPSGV
Download sequence
Identical sequences A0A1W5CKW6 Q3MBT8
gi|75908147|ref|YP_322443.1| 240292.Ava_1926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]