SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908435|ref|YP_322731.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908435|ref|YP_322731.1|
Domain Number 1 Region: 19-212,313-404
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.39e-88
Family Bacterial dinuclear zinc exopeptidases 0.0000201
Further Details:      
 
Domain Number 2 Region: 196-314
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.66e-32
Family Bacterial exopeptidase dimerisation domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908435|ref|YP_322731.1|
Sequence length 405
Comment peptidase M20D, amidohydrolase [Anabaena variabilis ATCC 29413]
Sequence
MVSTFPNSASVDLSRVRLAIRSLQPQLVEWRRRLHQKPELAFQEKITAAFVSSKLQAWGI
EHQTSIAQTGIVATIKGEKPSTQVLAIRADMDALPIQELNEVPYCSQHNGVMHACGHDGH
TAIALGTAYYLQQHRQNFAGTVKIIFQPAEEGPGGAKPMIEAGVLKNPDVDAIIGLHLWN
NLPLGTVGVRSGPLMAAVELFDCTIFGKGGHGAIPHQTVDSVVVAAQIVTALQTIVARNV
NPIDSAVVTVGALHGGTTHNVIADTATMKGTVRYFNPAFQGFFPQRIEQVIAGICQSHGA
KYDFKYTELYPPVINDQAIAQLVRSVAAEVIETPIGIVPECQTMGGEDMSFFLQEVSGCY
FFLGSANPDKDLAYPHHHPRFDFDETALAMGVEIFVRCVEKFFNE
Download sequence
Identical sequences A0A1W5CNI9 Q3MB00
240292.Ava_2218 gi|75908435|ref|YP_322731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]