SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908485|ref|YP_322781.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908485|ref|YP_322781.1|
Domain Number 1 Region: 403-580
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.34e-51
Family N-acetylmuramoyl-L-alanine amidase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908485|ref|YP_322781.1|
Sequence length 585
Comment cell wall hydrolase/autolysin [Anabaena variabilis ATCC 29413]
Sequence
MKKVLIPVILSCVVTSSVALSSSPLKVVYPPTNHQTSAEKIFFIGTAPPNGQVLVNGKPI
NRSRSGHFAPSFPLQLGENIFTVRHQNQELQIKVTRLSNQPELPQGLAFAKGSLTPTADI
ARLPGELICFSAIAPPNASVSVKLGNQTVALLPQPQQAILPSNLAALTGQNQPTTQSIPG
KYEGCTTVSVATDLEQPQYQLTLNGKTITQPSAGKITILSPTQLPVAEVVADAGVARTGP
STDFSRLTPLPKGTRATVTGKEGEWFRLEYGAWINSQETRILPGSVPPRTVIRSVGYRRL
PGTTEMLFPLQTPVPVSVQQGEKTFTLTLYNTTAQTDIIRLDDDPLISRLDWQQIASGEV
KYTFNLKKAQQWGYKLRYDGTTLVLALRHAPVIRQNRQKPLSGIKILLDPGHGGKESGAT
GPTGYLEKDVNLAVSKLLRDELLKLGANVVMTRDDDRDVSLPERQAIINREEPAIALSVH
YNSLPDNGDAENTKGVGTFWYNAQAHSLAVFMHNYLVNKLRRPSYGVFWNNLALTRPAAA
PSVLLELGFMSNPDEFEWVTNPQEQKKLAEVLAEGITEWFRSVKS
Download sequence
Identical sequences A0A1W5CCJ6 Q3MAV0
gi|75908485|ref|YP_322781.1| 240292.Ava_2268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]