SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908566|ref|YP_322862.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908566|ref|YP_322862.1|
Domain Number 1 Region: 34-131,187-354
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.38e-47
Family Filamentous hemagglutinin FhaB, secretion domain 0.006
Further Details:      
 
Domain Number 2 Region: 355-499,529-559
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000132
Family P22 tailspike protein 0.058
Further Details:      
 
Weak hits

Sequence:  gi|75908566|ref|YP_322862.1|
Domain Number - Region: 564-652
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0345
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908566|ref|YP_322862.1|
Sequence length 804
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MTMLPCCDPVSGQVIPDGSVNTRVSQSGDLFTITDGNRVGDNLFHSFSQFSVPSNGTAFF
NNASDVQNIFSRVTGASVSLIDGLIQANGNANLFLLNPKGIIFGANAQLNIGGSFISTTA
NSIEFADGIEFSSINSQPAPLLSINVPVGLQLGNNPAPINLQGTGHTLTNTSGLTLAPLI
RTPHPTKLQVPSGKTIALVGGDINLNGATLIAETGGIELGSVISPGLVNLIPSAQGYTLG
YSNIQHFGNIQLAERSLLDISGVNAGSVQIRGGQLRFTDGSLILSQNFGARPGGEIRLQT
TESIELIGRTSDVGIRGGIRSEALGIGNSSNINIITPILTVSQGAGVTNSTLGSASSGNI
NIEATATYLSGFSPTNPVEVTTINTSTLGSGNAGDLFFNGSSLLISDGASLSSTTFGNGS
SGKVTIRNTNTTVIGESPSELYSNISSTTFATGNAQTLTLDTKNLQILDGGAVATTAFFV
GSGGDLSINASESITISGQGRTISSSINASTLRPDPFLRQRFGLPDILTANPGSVSITTP
KLTLTNGGTVGVTNQGSGNGGNMSIATNTIQLKNQGFIQAQTKFGNGGNIQLSATDLLLL
RQNSLITSTSGGSGNGGNININAPIITGLENSDIIANAIRGQGGNIQITTQGMFGLKFRD
QITPESDITASSQFGLSGTVQVNTVGVDPNSGLVELPANVTDPSQKIATGCSNNQGSSFI
AIGRGGVPQNPTQEIRSDRSWSDTRDISAYRETQTVQAQIPQPPETLVQATSWQRNPQGK
IELVVAKSPPQMPPALTCAAVVEN
Download sequence
Identical sequences Q3MAL9
240292.Ava_2349 gi|75908566|ref|YP_322862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]