SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908567|ref|YP_322863.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908567|ref|YP_322863.1|
Domain Number 1 Region: 20-150,184-361
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.39e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.0091
Further Details:      
 
Domain Number 2 Region: 378-512,542-572
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000298
Family P22 tailspike protein 0.071
Further Details:      
 
Weak hits

Sequence:  gi|75908567|ref|YP_322863.1|
Domain Number - Region: 575-667
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0439
Family Filamentous hemagglutinin FhaB, secretion domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908567|ref|YP_322863.1|
Sequence length 816
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MKLTFVGFGVLSVIWLSAVYNYSVHAQVTPDNTLNTSVTSTTSMSGSNSYTINNGTRVGN
NLFHSFSQFSILSGGSASFDNATDIQNIFSRVTGGNISNIDGDISAKGSANLFLLNPAGV
IFGQNASLNIGGSFITTTANSIKFADGTEFSALQGADQPLLTMSAPVGLQMGSNSASIKT
QGRGYANSGSFIVPTPNSTELQVNPGKTLALVGGNLQIDGFILNAPEGRVELGSTNGTGQ
VSLIPNAQGYTLGHEDEQIFGDIQLAKKSLINVSGVNSGSVRLQARNILLTDGSLILAQN
YGYLPGGEISLQASTAIDLIGRSSDGNVLSGVRSETYGIGAGGNIGIFTRKLTLQEGSGL
NNITLGTAPSGNIEINAKTIEISGFSQVNPNGVTSIGTLSFASGSAGDVFANSDNLLISG
GASLSSVTFGSGSSGKVSIRNQNTTVIGNSPSGFDSAITLATFAFGDNKDLILDTGKLQI
LDGGRIGSSTLFAGNGGNVSINASEAITISGRNDNNNSAINSSATRLNAQLRQSFGFPDM
LTANAGSLSITTPNLILTDGATVTVTSEGTGNAGNLNVIADIIQLKNQALIQAQTESGNG
GDIDLKVGSLLLMRDRSKITTTAGSTGNGGNININSPTIVGLENSDITANAVRGKGGNIN
ITTQGIIGLEYRSQLTPENDITASSEFGVNGTVQVDNVGVDPNSGLVALPTNFTDSSQKI
ASGCADNSGSSFVATGRGGVPQNPNQELRSDRTWSDIRDMSEYRNTGAVTAQIPKFLVLV
QATGWRHNAQGKIELVADKSSAQVKPALTCAPVAQS
Download sequence
Identical sequences A0A1W5CC27 Q3MAL8
gi|75908567|ref|YP_322863.1| 240292.Ava_2350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]