SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908570|ref|YP_322866.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908570|ref|YP_322866.1|
Domain Number 1 Region: 50-364
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.95e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.0099
Further Details:      
 
Domain Number 2 Region: 453-518,550-579
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000518
Family Pectate lyase-like 0.069
Further Details:      
 
Domain Number 3 Region: 590-674
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000722
Family P22 tailspike protein 0.069
Further Details:      
 
Weak hits

Sequence:  gi|75908570|ref|YP_322866.1|
Domain Number - Region: 374-453
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908570|ref|YP_322866.1|
Sequence length 824
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MKLTFVGLGVLSVICLSAVDNNSVHAQVIQDNTFNTSVTPTTSMNGSNAYTINNGTRVDN
NLFHSFSQFSIPTGDSAFFGNDLSIENIFSRVTGGNISKIDGSINANGKANLFLLNPAGI
IFGKNASLNIGGSFVATTANSIKFEDGTEFSAVNPAAKALLTMSVPVGLQMGSNPGQITV
QNTGHQLAFPIHPLVSSPNRSNNPVGLNVNNGNLALIGGKITLDGGVLNAPSGHIELGSA
SNGIVNLNTASQSWNFDYSNIQQFGDIQLSRQSLADASGTPAGSIQFVGQNISLNDASAA
LLVNEGNGNSGNINIDASGSLTLRGTGTIGFPQSLLRADNFSDGSGGNIIASASQVFLQD
GGSLHGINFAEGTGSNIFVETQDLIQITGISPVSGFASSLNTITRGSGKSGDIQVATNKL
QVLDGAVIGNSPWSNGAGGNITINASDFIEVAGENTKNLADSVIVVGTFDEGNSGLLTIN
TAQLRVRDGGGIVVSTVNQGNAGDLVINASDTVEVSGVGSISGLPSRIGVRAELLAPPIR
QLFGLPDVITGNIGKLTLNAQRLQVTNQAIVGVDHQGIGDAGQLEVNADSIRLDNGGSIT
AATVQGEGGNILINSNDLLLRHGSSIMTNADGIGNGGNMTINSAVILALENSDIVANAVQ
GNGGNINITSQSIFGLKYRNELTTESDITASSQFGLNGTVNIYHFGVDPKTALVELPKNT
IDPSKQIASGCNANTGSSFVATGRGGIPQNPTQEIKSDRTWSDIRDISAFHTKQQAQAPK
NPVTLVQATSWRRNANGKIELFAAKSPTGVQMSLTCASLAKSQP
Download sequence
Identical sequences A0A1W5CC29 Q3MAL5
gi|75908570|ref|YP_322866.1| 240292.Ava_2353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]