SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908571|ref|YP_322867.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908571|ref|YP_322867.1|
Domain Number 1 Region: 2-405
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.32e-77
Family AAT-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908571|ref|YP_322867.1|
Sequence length 411
Comment L,L-diaminopimelate aminotransferase [Anabaena variabilis ATCC 29413]
Sequence
MATINDNYLKLKAGYLFPEIARRVNAFAEANPDAKIIRLGIGDVTEPLPEACRTAMIQAV
EEMGDRSSFKGYGPEQGYAWLREKIATQDFQARGADVDASEIFISDGSKCDTGNILDIFG
DNNIIAVTDPVYPVYVDTNVMAGHTGVANDKGEFEGLVYLPVTAENNFTAEIPSQKVDLI
YLCFPNNPTGATATKEHLQAWVDYAKAHNSIIFFDAAYESYITDPSLPHSIYEIEGAREV
AIEFRSFSKNAGFTGTRCALTVVPKTLKAKAADGSDVELWKLWNRRQSTKFNGVSYIVQR
GAEAVYSEAGQAQVKALVSFYLDNAKIIREKLTAAGLSVYGGVNAPYVWVKTPNGLSSWD
FFDKLLQTVNVVGTPGSGFGAAGEGYFRISAFNSRENVEEAMQRITEKFKL
Download sequence
Identical sequences A0A1W5CC19 Q3MAL4
gi|75908571|ref|YP_322867.1| 240292.Ava_2354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]