SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908716|ref|YP_323012.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908716|ref|YP_323012.1|
Domain Number 1 Region: 187-353
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 2.49e-43
Family HI0933 insert domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 4-187,350-407
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.93e-42
Family HI0933 N-terminal domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908716|ref|YP_323012.1|
Sequence length 413
Comment fumarate reductase/succinate dehydrogenase flavoprotein-like protein [Anabaena variabilis ATCC 29413]
Sequence
MLPSKIVVVGGGAAGFFGAIACARVNPQAEVTLIEASRQTLAKVSVSGGGRCNVTHACFD
AHELVQYYPRGGKALRGAFARFQAKDTVDWFATQGVRLKTEADGRMFPITDSSETIVDCL
MNAATAAGVEILTGVAVASIKQSQGNQFEIFCRSGKIINCDRLLLATGSSRVGYQIAQEL
GHHIESPVPSLFTFNISEAKLRALAGISVNPARLRLCADGASPLEQTGPLLITHWGLSGP
AVLKLSAWGARLLHDKRYQATLLVNWLPDFSQEQVRQNILAIKNEWGKRAIALHRGVDLP
HRLWQYIIARVGITTDERWAGLSNKTLNLLVQELTQGQYLISGKGVFKEEFVTCGGVNLK
EINFKTMESKLVPNLYFAGEILDIDGVTGGFNFQSAWTTGYLAGTAMGEHSAD
Download sequence
Identical sequences A0A1W5CD01 Q3MA69
gi|75908716|ref|YP_323012.1| 240292.Ava_2502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]