SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908744|ref|YP_323040.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908744|ref|YP_323040.1|
Domain Number 1 Region: 23-263,307-406
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.42e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908744|ref|YP_323040.1|
Sequence length 776
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MNNFWVWIPKLGVAIAGVLTCMTDYAVAQVVHDNTLINNSQINTHNNIISIEGGTRAGDN
LFHSFEQFSVAQGITAEFKNAVDVKNIISRVTGNSISQIDGILKSQYEANLFLINPNGII
FGSNASLNIGGSFVATTADTLIFADRRNYSTRELSLVPSPLSISVPIGLQFGANPGSIHN
QSQTSPNGAMNSLFEPVGLQVKPGKTLALVGAGLIMEGGNLTAPLGRIELGSVGSNSYVS
LSLVNQGWILGYQGIQDFQDIRLIQRTVDGSAFPSQIDVGGDGGGNIHIQGKAVEMNGRD
VRLSTQTLGFNKAGDITIDANKLVIRNGAQILTFTFAQGAGGNLVINAAESVEVIGGFLV
PNTNRVEPSALTSSTASDGKAGDITINTKRLIVQVGGNISTSSLGLPDFNNERIILATGA
GGDLIVNAADSVEISGKARNVPSSLSASTNSYGNAGKLMIITGKLTVKDSSEVAVGSVVL
KFAGLRVDNSNLGSAGELNITARSIVLDNQGKLLSNSESGQGGNIEIQVQNTLLMRRNSQ
ISTNAGITSGRGDGGNIIINAPNGFIIGTPNENSDITANAFSGSGGKITINTNSVLGFVP
RNRAELVKLLATENPKKLDPNKLPSNDITAFSQENPSFNGIVQINTPDADPSKGLIELPR
NIIDTSEKIVASCHPSRISQRSSFVSTGRGGIASSPTDTLIDDAVLVGWAALPTQIESSA
DSIPEQHAQQDNLNVSPQILEAQGWQIDRDGNIVLVAQAPTVNPHTPTLHSSACTE
Download sequence
Identical sequences A0A1W5CGZ4 Q3MA41
gi|75908744|ref|YP_323040.1| 240292.Ava_2530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]