SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908804|ref|YP_323100.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908804|ref|YP_323100.1|
Domain Number 1 Region: 48-171,227-452,486-507
Classification Level Classification E-value
Superfamily Thiolase-like 2.88e-73
Family Thiolase-related 0.00016
Further Details:      
 
Domain Number 2 Region: 623-761,828-931
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.37e-58
Family FabD-like 0.0003
Further Details:      
 
Domain Number 3 Region: 1434-1518
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000000654
Family Acyl-carrier protein (ACP) 0.013
Further Details:      
 
Domain Number 4 Region: 1298-1377
Classification Level Classification E-value
Superfamily ACP-like 0.000000000000327
Family Acyl-carrier protein (ACP) 0.013
Further Details:      
 
Domain Number 5 Region: 764-827
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000000103
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0023
Further Details:      
 
Domain Number 6 Region: 1553-1744
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000251
Family Tyrosine-dependent oxidoreductases 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908804|ref|YP_323100.1|
Sequence length 1764
Comment beta-ketoacyl synthase [Anabaena variabilis ATCC 29413]
Sequence
MSANPIDTALAELEAQINNCEKALLRCIEEKKMKSEKPMSINKINRQLQHNPIAIIGMAS
LLPEARNLREYWQNIVNKIDCITDVPSTHWSVEDYYDPNPRTTEDKTYCKRGGFIPEVDF
NPMEFGIPPSILEVTDVSQLLSLVVAKEAMEDAGYGESREFNRDLVGVILGVAMAKQLGM
PLSARLEYPIWEKVLKNSGLSDEDTKKIVDKIKSAYVKWDENAFPGMLANVVAGRIANRL
NFGGMNCVVDAACASSFGALKMAISELVEHRADMMLTGGVDTDNTIMAYISFSKTPAVSP
GDNVKPFDAKSDGMMLGEGICMLVLKRLEDAERDGDRIYAVIKGIGTSSDGRYKSIYAPR
KEGQVNALRRAYEDAGFSPATVGLMEAHGTGTMAGDPTEFGSLRDFFGEHDKKKQHIALG
SVKSQIGHTKAAAGAASLVKTALALHHKVLPATINITEPNPKLNITESAFYLNTETRPWI
RPEGEPPRRAGVSSFGFGGTNYHVVLEEHEAEQNRPYRLHNSASEILLFAANPAELLKQC
EEVLGKLQSEGGDKHYSQLVRDCQALQIPQNAARVGFVAENLQEACKFMQTSIDWLKHKA
GVANWEHPQGIYYRASGMELNGKVVSLFSGQGSQYLEMGRELVMNFPTLRRLFGYMDGLL
LKDNLRPLSEIVFPHPVFSEAEKNAQVAALQRTEYAQPAIGAFSAGLYAILKQAGFKSDF
VAGHSFGEITALWAAGVLSDADYMYLVKARGQAMAAPEDPDHDAGTMLAVKEDLSKIEPI
LKQFPQVSIANYNSPTQIVLAGPTAEIAKVRQALQAQGYAAVPLPVSAAFHTSLIAFAQK
SFAIATKSVQFNEPKIPVFTNVTGKPYPKEPQAIQKILETHLANSVLFKQEIENIYAAGG
HCFVEFGPKRILTNLVKDILGDRPHITVSLNPSTQKNSDRSLREAAVQMRVIGMQLQNLD
PYQAPPALPPTETKKGLSVTLRGINYRSEKTKKAWEDAMNDGFKVSLPPAPTVTVPPVKE
TNGNGHSKISELPKIINNSTSVTPVKPEMNSAIVSPQLVEEKKMQTPEKLDNYKRVLESL
EYLTTQFQQNQTENLQVHGTYLNHQMEYTKAFFQLMQQQNTLFANAKSSQEAAQLKLVVM
ESLERSMMQFHSQQGETLRIHEKYLQEQVAYAREFFELIQQQYSMVLSGQVNPPATPTPV
KEVPAFTIEAPVTPTPKIVEPQPESVVKNGFSIVDAPIPPAPTTWEIQSELVVTAPASVV
STIEPEPVIAAPVVNQVAEFTPAPAPVVAPVITPAIDVADLDKNLLAIISDKTGYPVEML
ELEMDMEADLGIDSIKRVEILGGLQEVYPDLPKPNLEELAEKRTIGQIVDYLKANTAISQ
SVGIAIQQAQQAAEMPTLVVTASIPTPAPVVVPEPVAIPATPAPAAPTDTSDYADLGQTL
LNITSDKTGYPVEMLELDMDMEADLGIDSIKRVEILGAMQEAYPNLPKPNIEELGDLRTI
RQIVDYLQKLAGGEKKKSQSERDWQPVSIIGNVPRCPAKLKYLPTPDSLDFSLPEGHICL
ITDDGSLTTSQVAQSLTERGWKVVVLSFPQSLVPHQSTLPASVHRVTLADMSEELLQHKL
SAIATNYGKIGAFIHIHPVFQNLGIYIPQEKSIVKHVFFLAKHLKKSLTEAGRYERSCFV
TVTRLDGAFGLEHNTNFGAIAGGLFGLVKTLRWEWPNVFTRGIDLSPALNPQQSAQFILD
ELHDSNLYIPEVAYGSQGRVTLIS
Download sequence
Identical sequences A0A1W5CIR2 Q3M9Y1
240292.Ava_2590 gi|75908804|ref|YP_323100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]