SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908946|ref|YP_323242.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75908946|ref|YP_323242.1|
Domain Number - Region: 38-103,133-160
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.025
Family Tryptophan biosynthesis enzymes 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908946|ref|YP_323242.1|
Sequence length 167
Comment hypothetical protein Ava_2734 [Anabaena variabilis ATCC 29413]
Sequence
MWFGYQEAKNAYTQPQAVIVLGGSTRNLEREKFTASFARQHPNLPIWISGGSPPVYTKRV
FKKAGIDTKRLHLDYEAVDTVTNFTTLIDELQSRGIKSVYLITSDFHMRRACIIGEIVLG
SRGITFKPISVPSENSPEPIEKSLRDGARALLWVATGYTGADEKHKR
Download sequence
Identical sequences A0A1W5CQ54 Q3M9I9
gi|75908946|ref|YP_323242.1| 240292.Ava_2734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]