SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908974|ref|YP_323270.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908974|ref|YP_323270.1|
Domain Number 1 Region: 37-462
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.16e-108
Family Glycine dehydrogenase subunits (GDC-P) 0.00000129
Further Details:      
 
Domain Number 2 Region: 496-903,946-968
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.38e-99
Family Glycine dehydrogenase subunits (GDC-P) 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908974|ref|YP_323270.1|
Sequence length 974
Comment glycine dehydrogenase [Anabaena variabilis ATCC 29413]
Sequence
MVSYASIRQSSDEADSTVDASQKLDARKQDLNNFIQRHIGPSSADIQHMLDVLGFSSLDD
LIEKTVPSTIRLHKKLQLPTAQTEYAALAKLKQIASKNQVFRSYIGMGYYDTITPPVIGR
NILENPGWYTAYTPYQPEIAQGRLEALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSM
SYGVSKNKANAYFVSHDCHPQTIDVLQTRAKPLGIEIIIGDHQTFDFQKPIFGAVLQYPA
SDGTIYDYRAFIETAHAQGALVTVAADPLSLTLLTPPGEFGADIAVGSTQRFGIPLGFGG
PHAAYFATKEEYKRQVPGRIVGVSKDVNGKTALRLALQTREQHIRREKATSNICTAQVLL
AVMASMYAVYHGPEGLKQIAENIHQLTVTLAEGLKRLGYKISSEHFFDTLRVELGTNNLE
TILAGCQARNINLRIFDETAVGISLDETTTPEDLIDLWQIFAGEDNLPFTPEELISSLNL
PLRSSSYLTHPVFNRYHSETELLRYLHRLETKDLSLTTSMIPLGSCTMKLNATSEMIPVT
WEEFGRIHPFAPLTQTRGYQILFQQLEAWLAEITGFAGVALQPNAGSQGEYTGLLVIRQY
HESRGETHRNVCLIPTSAHGTNPASAVMCGMKVVAVACDAGGNIDIDDLKAKAEKHSHEL
AALMVTYPSTHGVFEAGIQEICAVIHSHGGQVYMDGANMNAQVGICRPGDIGADVCHLNL
HKTFCIPHGGGGPGMGPIGVASHLVRFLPGHPVLGSGKNPQNIGAVAAAPWGSASILVIS
WMYIAMMGADGLTQATKVAILNANYIAKRLETYYPVLYKGQNGLVAHECILDLRALKKSA
NIEIDDIAKRLIDYGFHAPTVSWPVTGTIMVEPTESESQAELDRFCDALIAIRQEIAAIE
AGKMDTHNNLLKNAPHTIESLIVGEWLHPYSREQAAYPVSWTREYKFWPSVGRIDAAFGD
RNFVCSCLPMEAYN
Download sequence
Identical sequences A0A1W5CQM2 Q3M9G1
gi|75908974|ref|YP_323270.1| 240292.Ava_2762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]