SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909022|ref|YP_323318.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909022|ref|YP_323318.1|
Domain Number 1 Region: 27-358
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.1e-32
Family Filamentous hemagglutinin FhaB, secretion domain 0.0078
Further Details:      
 
Domain Number 2 Region: 591-750
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000107
Family Filamentous hemagglutinin FhaB, secretion domain 0.043
Further Details:      
 
Domain Number 3 Region: 815-912
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000643
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 4 Region: 350-492
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000141
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Domain Number 5 Region: 493-619
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000471
Family Filamentous hemagglutinin FhaB, secretion domain 0.075
Further Details:      
 
Weak hits

Sequence:  gi|75909022|ref|YP_323318.1|
Domain Number - Region: 749-815
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0345
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909022|ref|YP_323318.1|
Sequence length 1152
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MIKRNYLNRCLSLSLLVSVTLTTNGKILAQVTADQTLETQVIDIGLNSFILGGTTVGNTN
LFHSFASFNVPSNGAAIFINDPSLTNIFARVTGGTASDVQGRIGTQGTANLYLINPNGII
FGTNASLNIGGSFVATTANVIQFPGGAEFSLNSSVSPDNHLLRVNPTAFLFNQIANQGTN
SIENRAYLGVPNNRSLILLGGNIAPTSHTTGRIIIDGGVVQALGGRVEIGGLVEPGSIGI
NIDGNKFSLNFPDSVAKTDISLINNSALFISGAGGGDIIVNADNLSLNSSYFFAGILNNQ
GNPETKAGDISINATGIVTVAQNSIIGNSSVGIGDSGNINIFGQSLQIIGNSAVQSSALQ
GNSGTINIKVDDTIALLGSQIGSIVRPRDTSVSSLQSRLLGTPTRGKSGGINIQARNLLA
VDSSSISASNFLADDSGDIKIQAADTVILNNRGSISSTAFGQGKSGNLSISTNRLNVINY
SQIAANTLGTGNAGDININAEDINIEDKSFITSSTSSFFNTISNVGNAGNINIQTSRISV
KNSGFIISISGDREQALTNGLGGNINITATELIEIDAKGATDIITGFSAKTFSDSRAGDI
TLNTKNLIVRNGGAITAEAANSLGGNAGNININASDTVKLISSPGNSYSRIFTGVVSSDN
NVTNAGNGGELKITTGKLQLTNGIISAATFGQGHAGNITIFSNDEIVLDSGLIFSLVGAG
AVGNGGDINIQTPRLTLTNGSQVDASIRGGGIGKGGTIRIDAADYVIISGRDADGFESFL
AAETSRGGIGQPGDIIVNTDYFLLEKNGFVTTGTFNSSNGGSITINTRIFEALTGGQIFS
STGSSGKAGDIIINATDSIIVSGVNAETGNNAAIVAGTLADSTGNGGTVSLSTNNFHLSN
EAGVLTRSQGRGIAGDINITARGNFYVNHAFVSAQAEQAGGGNIDITAKNINLRNNSDIR
TDLSNGSGRGGGISLTANTIIALEDSDILAFAPEGQGGDIKFNTRAVFSDSLYTDRQTIP
DRNSLQSLVSNGSSDINATGTISGNIIGVPDISSIQNGLTDLQANPIDTTVLIANSCIAR
SLRQEGSFVITGTGGLPTRPGEVMASSYATGDVQSVSDESKASLWKKGDPIIEPQGVYRL
ANGVVVMSRECH
Download sequence
Identical sequences Q3M9B3
240292.Ava_2810 gi|75909022|ref|YP_323318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]