SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909023|ref|YP_323319.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909023|ref|YP_323319.1|
Domain Number 1 Region: 26-357
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.19e-32
Family Filamentous hemagglutinin FhaB, secretion domain 0.0081
Further Details:      
 
Domain Number 2 Region: 570-723
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000105
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 
Domain Number 3 Region: 472-596
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000119
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Weak hits

Sequence:  gi|75909023|ref|YP_323319.1|
Domain Number - Region: 794-879
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000314
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number - Region: 382-471
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00239
Family Filamentous hemagglutinin FhaB, secretion domain 0.045
Further Details:      
 
Domain Number - Region: 732-796
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0345
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909023|ref|YP_323319.1|
Sequence length 1140
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MIKRKNLNWVINLGLLFSLVVATNNRTSAQVTADQTLETQVIDIGFNSFILGGTTVGNTN
LFHSFASFNVPSNGAAIFINDPSLTNIFARVTGGTASDVQGRIGTQGTANLYLINPNGII
FGTNASLNIGGSFVATTANAIQFPGGAEFSLNSSVSPDNHLLRVNPTAFLFNQIANQGIN
SIENRGSLGVPNNKSLILLGGNIAPTSHATGGILLDNGRLGALDGRVEIGGLTAPGSVGI
NVKGNNLSLSFPQGVARTDIALINNTGVLVAGVRGGDVLVNANNLNLLNSTNIFTGIFAN
QGKPDSKTGDISINATGIVNLTEGSGIGNLSLGIGDSGNINIVAQSLNMKNGSSIQAITA
QGESGIVNIKVTDTLSLNQGLLANVILSDRINIQAQKVSLANGALIRAFNSSGNDSVGIK
IQAFDSLELNNASILTGTFENGNSGDLSIITNRLNLKNDSQIAANTFGSGNAGQININAA
DIAIDLSSISAASLSFPGVITNIGNAGTINIQTERISLTNRGFISSSSDEPEQGTTIGYG
GNINITANELIEIDAKGATGIITGLVARTFSGSSAGDINLNTRNLIVRDGGYISVEAANN
LGGNAGNITINASDAVELTSSNGNRPSIIFTGVSAFNDNAIAVGNGGDLKIITQNLQLTN
STISAGTFGQGNAGNINIFSNDGVVIDNSVINSRIGAGAVGNGGDIDIQTQRLTLTNGGG
IDTIVAPPEGNLPGGLGKGGTIRINATDAVTISGTNADGFESAILTETQSGAFGQSGDII
INTNYFRVLDNGSVSTLTGNSSDAGNILINTRVMEVLNGGVIVTGTEASGKAGDITINAT
DQINILSNTDLNGNTGLVASTTSSGDAGNISLFTTDLNLLAPNSNLPAPVLVATLSRGSG
IAGNINIVATGNYNANNGLISARSERAGGGNISVNARNINLRNNSDIRTDLSSGNGRGGG
ISLTADIIISLEDSDILAFAPEGQGGDIKFNTRAVFSNVLYTARQTIPDRNSLQSLVNNT
RPDINATGTISGNIIGVPDISSIQNGLTDLQANPIDTTVLIANSCIARSPRQEGTFIITG
TGGLPTRPGELKASSYATGDVQSVSNNIVASAWKKGDAIIEPQGVYRLANGEMVMSRECG
Download sequence
Identical sequences Q3M9B2
gi|75909023|ref|YP_323319.1| 240292.Ava_2811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]