SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909051|ref|YP_323347.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909051|ref|YP_323347.1|
Domain Number 1 Region: 54-478
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-118
Family GABA-aminotransferase-like 0.000000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909051|ref|YP_323347.1|
Sequence length 493
Comment diaminobutyrate--2-oxoglutarate aminotransferase [Anabaena variabilis ATCC 29413]
Sequence
MQLNHNGVHSEGHSFVVPQICPSQSSVGSDFPSNRVHSLPGEASSQYLERQQARESNARS
YPRRIPIAISEAQGIYIKDADGNVYIDCLAGAGTLALGHNHPVAIEAMRKVLDGGLPLHT
LDLTTPVKDKFVEELFASLPPEFAQNVKIQFCGPSGADAVEAAIKLVKTATGNRSVLSFH
GGYHGMTHGALSLTGNLNPKQAVTGLMPDVHFLPYPYHYRCPFGLGGEAGQRTSSRYIES
ILDDPESGIVTPAAMILEVVQGEGGVIPAPDDWLREMRRITRDRHIPLIVDEIQTGLGRT
GKLYAFEHSGIMPDVLLLSKAIGGSLPLSVVLYNKELDKWSPGAHAGTFRGNQMAMAAGT
ATLQYILENSLTEHAAAMGDRLLKHLHQIQGETYCIGEVRGRGLMVGVEIINPQASADRR
GKYPAHPQLASRIQAECLRRGLIVELGGRFGSVVRFLPPLIVTPAQIDSICEIFASAVQA
AEKQVLSVLSQVS
Download sequence
Identical sequences A0A1W5CIX4 Q3M984
240292.Ava_2839 gi|75909051|ref|YP_323347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]