SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909255|ref|YP_323551.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909255|ref|YP_323551.1|
Domain Number 1 Region: 801-1187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-124
Family PFOR PP module 0.0000000195
Further Details:      
 
Domain Number 2 Region: 6-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.71e-78
Family PFOR Pyr module 0.0000000597
Further Details:      
 
Domain Number 3 Region: 421-675
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-78
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000501
Further Details:      
 
Domain Number 4 Region: 261-418
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000601
Further Details:      
 
Domain Number 5 Region: 672-845
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.53e-25
Family Ferredoxin domains from multidomain proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909255|ref|YP_323551.1|
Sequence length 1190
Comment ferredoxin (flavodoxin) oxidoreductase [Anabaena variabilis ATCC 29413]
Sequence
MKNRTFATIDGNEAVAQVVYQINEVIAIYPITPSSPMAEWSDAWASEGKPNIWGTVPTVV
QMQSEGGVAGAVHGALQTGSLTTTFTASQGLLLMIPNMYKIAGELTPTVFHIAARSLAAQ
ALSIFGDHSDVMATRGTGFAMLCAASVQEAHDFALISTRITLESRIPFLHFFDGFRTSHE
INKIELLTTEDFKGFIPNELVIAHRSRALTPDKPVLRGTAQNPDVYFQARETVNPYYLAC
PEITQKVMDEFAQMTGRQYQLFEYHGDPTAERVIILMGSGCETVHETVDYLNALGEKVGV
IKVRLYQPFDSQRFIAALPTTTRGIAVLDRTKEPGASGEPLYLDVVTALYEKWGVGSLPT
VIGGRYGLSSKEFTPGMVKAVFDNLAATIPKNHFTIGINDDVSHTSLDYDPDFNIEPDNI
VRAIFYGLGADGTVGANKNSIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGSQLIRS
TYLINKASFVACHQWDFLEKFPILKDIVQGGTFLLNSPYDQDEVWERLPGKIQAQIQQKQ
LKVYVINAYKVAREAGMAGRINTVMQVCFFALSNVLPREEAIAEIKKYIRKTYGKKGDQI
VQMNIKAVDTTLDNLHELVTREYSAPPQIPNHHYPLSPEGAPPSSIPYILGKMIAREGDE
LPVSALPNDGTYPTGTAKWEKRNIAQEIPVWDTDVCIQCGKCVMVCPHSVIRSKVYEPEQ
LENAPSTFKSANAKDHDWHGLKFTIQVAAEDCTGCGICVDVCPAKNKAQPRKKAINMEPQ
LPLRQAERENWDFFLSIPNPDRRELKLTHINQQQMQEPLFEFSGACAGCGETPYIKLGTQ
LFGDRMIVANATGCSSIYGGNLPTTPWTQNAAGRGPAWSNSLFEDNAEFGLGFRVSIDKQ
TEIASQLLQELATVVGRELVDDILNNQQNNEAEIWEQRDRISILKQKLQALVNPELTSKA
QLLLSLADYLVKKSVWIIGGDGWAYDIGYGGLDHVLASGRNVNILVLDTEVYSNTGGQMS
KATPKGAVAKFASGGKPAAKKDLGLMAMTYGNVYVASVAMGAKDEHTLKAFLEAEAYSGT
SLIIAYSHCIAHGINLSTAMQNQKAAVDSGRWLLYRYHPDLVKQGKNPLQLDSRTPKLPL
EESMYLENRFKMLTKINPEVAKELLKEAQTDVNLRWQMYQYLAAREVTQG
Download sequence
Identical sequences A0A1W5CN90 Q3M8N0
gi|75909255|ref|YP_323551.1| 240292.Ava_3046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]