SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909355|ref|YP_323651.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909355|ref|YP_323651.1|
Domain Number 1 Region: 268-421
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000314
Family Serralysin-like metalloprotease, C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 82-194
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000314
Family Serralysin-like metalloprotease, C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 3-113
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000406
Family Serralysin-like metalloprotease, C-terminal domain 0.0027
Further Details:      
 
Domain Number 4 Region: 194-289
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000327
Family Serralysin-like metalloprotease, C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909355|ref|YP_323651.1|
Sequence length 493
Comment hemolysin-type calcium-binding protein [Anabaena variabilis ATCC 29413]
Sequence
MYNTIIGTPFNDLLVGTAVDDLIIALQGNDQIIGSFGNDLIVGDTGIDTVDYSELGQAVT
LQATGIVQKGRAGTDTLNGIETIIGAKGQANTIDTSTTTGSTTSVSVNLSANSLIVNGVP
TIGTLNFTVQRFVNVIGTTQNDSIIGDDNNNLLIGGQGNDEIFGFNGNDTVQGGAGDDVI
GGGSRNNLATSRLGDGNDIVQGEGGNDVLIGGTGNDTLDGGTDLDTADYSNLGTAIALQA
TGIVNKGVAGIDQILNIETIIGATRQANTIDGSTGTSTTTSFNVNLSTNSLIVNGVPVLG
TLNFNVQNFVNVTGTSQADTIVGNNQSNLLIGGRGNDQISGLGGKDTIIGVDPNSLQPGI
NEVDTLTGGADPDKFVLGDAKNPYYVGGGGFAGLNDFALITDFQTGQDQIQLKKLDGYIF
GSNYIAIASPFLLDSSKAFDDSLLVATANQIVKGNSVYDASSQSDLTSSSIFARFDIISI
FSTSYSVSDIHFV
Download sequence
Identical sequences A0A1W5CDC7 Q3M8D0
240292.Ava_3148 gi|75909355|ref|YP_323651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]