SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909383|ref|YP_323679.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909383|ref|YP_323679.1|
Domain Number 1 Region: 198-426
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.45e-67
Family CAT-like 0.0000977
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Single hybrid motif 1.57e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00037
Further Details:      
 
Domain Number 3 Region: 125-169
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000471
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909383|ref|YP_323679.1|
Sequence length 432
Comment branched-chain alpha-keto acid dehydrogenase subunit E2 [Anabaena variabilis ATCC 29413]
Sequence
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVEAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGGAAATPSAPPEPVAATAAVGVPAASQ
NGSNHREGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVADDIEAAVGKVKQPATTPTA
PTPTFTPAPVPATRTPAPAPAPAPVAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGLVYHPDINIAVAVA
MDGGGLITPVLKNADKIDIYSLSRTWKSLVDKARSKQLQPDEYSGGNFTLSNLGMFGVDT
FDAILPPGQGSILAIGASRPQLVATGDGSFAIKQQMQVNITSDHRIIYGADAAAFLQDLA
KLIETDAQSLTL
Download sequence
Identical sequences A0A1W5CQN6 Q3M8A2
gi|75909383|ref|YP_323679.1| 240292.Ava_3176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]