SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909385|ref|YP_323681.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909385|ref|YP_323681.1|
Domain Number 1 Region: 49-333
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.58e-39
Family Pectate transeliminase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909385|ref|YP_323681.1|
Sequence length 552
Comment hypothetical protein Ava_3178 [Anabaena variabilis ATCC 29413]
Sequence
MTHQGFNFSSLRNLCSILSLPTGITALLVASSGFMLVPSGVNAGAAPTLTAQVPTTASVI
YVNPTTGTDTASGGATAATPYKTITFALNQAQPGTIIQLAPGNYSSETGEQFPLILKPGV
TLQGDESARGQGVLITGGGFYTSRTFARQDITILANNDTTIAGITATNPNQRGTAVWVES
SNPIIRNNTFTNSVREGVFVTGTGNPKIQGNIFIQNKGNGVSVARSALGEISNNLFQDTG
FGIAIGGTSTPLVAENQIVQNQDGLYISETAKPVLRKNVIQNNKRDGVVATVNAQPDLGT
SENPGGNLIRSNGRYDVNNATKTIRILAVGNDIDQKKIFGQVDFVAASVEPPPSGQGTGF
TDVATNYWAKGYIEALASQNIIAGFPDGTFRPNEPVTRAQFATIVTKALTPEAKRNAINF
RDVSSNFWAFAAIQAAYRSQFVSGYPDGTFKPQQEIPRVQALVSLANGLGLTANNQNVIS
IYSDAGQIPGYAVGPVAAATTRQLVINYPTVSQLNPNRPATRAEIAAFVYQALVNAGRAQ
PLPSSYLVQVPQ
Download sequence
Identical sequences A0A1W5CQU9 Q3M8A0
gi|75909385|ref|YP_323681.1| 240292.Ava_3178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]