SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909486|ref|YP_323782.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909486|ref|YP_323782.1|
Domain Number 1 Region: 301-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-46
Family Ribonuclease PH domain 1-like 0.00000732
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.86e-43
Family Ribonuclease PH domain 1-like 0.0000246
Further Details:      
 
Domain Number 3 Region: 460-558
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-27
Family Ribonuclease PH domain 2-like 0.0000859
Further Details:      
 
Domain Number 4 Region: 143-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.1e-26
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 565-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.21e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 6 Region: 630-713
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.42e-17
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 
Domain Number 7 Region: 236-329
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000217
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909486|ref|YP_323782.1|
Sequence length 718
Comment polynucleotide phosphorylase/polyadenylase [Anabaena variabilis ATCC 29413]
Sequence
MAEFEKSISFDGRDIRLKVGLLAPQAGGSVLIESGDTAVLVTATRSAGREGIDFLPLTVD
YEERLYAAGRIPGGIMRREGRPPEKTILTSRLIDRPLRPLFPSWLRDDLQIVALTMSMDE
QVPPDVLAVTGASIATLIAKIPFNGPMAAVRVGLVGDDFIINPTYAEIEAGDLDLVVAGS
PHGVIMVEAGANQLPERDIIEAIDFGYEAVRDLIKAQLDLVAELGLEIVQEAPPEVDQTL
ENYIRDRASDEIKKILAQFELTKPERDAALDVVKDNIATAIAELPEEDPIRLAATANSKA
LGNTFKDITKYFMRRQIVEDNVRVDGRKLDQVRPVSSQVGVLPKRVHGSGLFNRGLTQVL
SACTLGTPGDAQNLNDDLQTDQSKRYLHHYNFPPFSVGETKPLRAPGRREIGHGALAERA
ILPVLPPKEQFPYVIRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPILKPVSGAAMGLIK
EGDEVRVLTDIQGIEDFLGDMDFKVAGTDAGITALQMDMKISGLSLEVIAQAIHQAKDAR
LHILDKMLQTIDTPRTETSPYAPRLLTIKIDPDMIGLVIGPGGKTIKGITEETGAKIDIE
DDGTVTISAVDENKAKRARNIVQGMTRKLNEGDVYAGRVTRIIPIGAFVEFLPGKEGMIH
ISQLADYRVGKVEDEVAVGDEVIVKVREIDNKGRINLTRLGIHPDQAAAAREAAAVNR
Download sequence
Identical sequences A0A1W5CBP5 Q3M7Z9
240292.Ava_3279 gi|75909486|ref|YP_323782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]