SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909516|ref|YP_323812.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75909516|ref|YP_323812.1|
Domain Number - Region: 48-160
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.045
Family Pectate transeliminase 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909516|ref|YP_323812.1|
Sequence length 188
Comment hypothetical protein Ava_3309 [Anabaena variabilis ATCC 29413]
Sequence
MLKSISSVAMTLIGFSTSLMFPHIAVAEEISCQRSLGAITVDNVKVPQGKTCTLTGTTVK
GNIVVEGSATLKAIGAKVNGSIQAEGASLVDVNSNTTVGGSIQVKQGRAARVVSTRINGD
VQLESNSRQIVANQNQIGGNLQVFQNTGGVMIQRNRINGNLQCKENTPQPIGGDNIVQGS
KEDQCARL
Download sequence
Identical sequences A0A1W5CBN3 Q3M7W9
gi|75909516|ref|YP_323812.1| 240292.Ava_3309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]