SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909584|ref|YP_323880.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909584|ref|YP_323880.1|
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.88e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 
Domain Number 2 Region: 3-67,167-325
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000178
Family FAD-linked reductases, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909584|ref|YP_323880.1|
Sequence length 429
Comment sulfide-quinone reductase [Anabaena variabilis ATCC 29413]
Sequence
MAHIVIVGAGLGGLPTAYELRHILPKQHQVTVISETPDFTFIPSLPWVAMGLTSLESIQV
SLQPRLKQKGINWILGRVDYLNPQDQKISFGEQSITYDYLIIATGAELALDAVAGLGPDG
YTQSVCNPHHAIKAFQAWQNFLLAPGPLVVGALPKTSCLGPAYEFTLLADYVLRKKGLRE
QVSITFVTPEPYAGHLGIGGMANSAELVTKFMAERGVEVIENAAVTAIEPNQIHLGNGRV
LPFAYSMLLPPFRGPRFVRQVPGLSNQDGFIPVLPTYRHPEYASIYAVGVVVEIKPPEVT
HIPLGVPKTGQMTEAMGMAVAHNIAIELGVFSAPPVTPTLDAICFADFGNSGILFLANPV
LPDVATGKRRRAVALSGTWVTWAKALFERYFLAKMRFGTAVPWFEKLALKLLGLSLVAPL
AVKRIIKEE
Download sequence
Identical sequences A0A1W5CN31 Q3M7Q1
240292.Ava_3378 gi|75909584|ref|YP_323880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]