SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909690|ref|YP_323986.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909690|ref|YP_323986.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.6e-16
Family 7-Fe ferredoxin 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909690|ref|YP_323986.1|
Sequence length 81
Comment photosystem I subunit VII [Anabaena variabilis ATCC 29413]
Sequence
MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAAQVASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences A0A0T7BV91 A0A139XA92 A0A1W5CDX2 A0A1Z4KJD3 A0A1Z4NFB3 A0A1Z4RBC7 A0A1Z4UKD7 A0A218Q5S6 A0A2A2TK75 A0A2I8AEF5 K9X3N5 P0A410 P0A411
gi|17230955|ref|NP_487503.1| WP_010997613.1.17284 WP_010997613.1.18086 WP_010997613.1.33676 WP_010997613.1.34296 WP_010997613.1.47433 WP_010997613.1.6664 WP_010997613.1.68900 WP_010997613.1.87691 WP_010997613.1.93177 gi|434406461|ref|YP_007149346.1| 103690.asr3463 240292.Ava_3484 gi|75909690|ref|YP_323986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]